Human SARAF/FOAP-7/HSPC035 ORF/cDNA clone-Adenovirus particle (NM_016127.5)

Cat. No.: vGMAD000731

Pre-made Human SARAF/FOAP-7/HSPC035 Adenovirus for SARAF overexpression in-vitro and in-vivo. The SARAF adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified SARAF-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to TMEM66/SARAF/SARAF/FOAP-7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD000731 Human SARAF Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD000731
Gene Name SARAF
Accession Number NM_016127.5
Gene ID 51669
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 1020 bp
Gene Alias FOAP-7,HSPC035,TMEM66,XTP3
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Kanamycin
ORF Nucleotide Sequence ATGGCCGCAGCCTGCGGGCCGGGAGCGGCCGGGTACTGCTTGCTCCTCGGCTTGCATTTGTTTCTGCTGACCGCGGGCCCTGCCCTGGGCTGGAACGACCCTGACAGAATGTTGCTGCGGGATGTAAAAGCTCTTACCCTCCACTATGACCGCTATACCACCTCCCGCAGGCTGGATCCCATCCCACAGTTGAAATGTGTTGGAGGCACAGCTGGTTGTGATTCTTATACCCCAAAAGTCATACAGTGTCAGAACAAAGGCTGGGATGGGTATGATGTACAGTGGGAATGTAAGACGGACTTAGATATTGCATACAAATTTGGAAAAACTGTGGTGAGCTGTGAAGGCTATGAGTCCTCTGAAGACCAGTATGTACTAAGAGGTTCTTGTGGCTTGGAGTATAATTTAGATTATACAGAACTTGGCCTGCAGAAACTGAAGGAGTCTGGAAAGCAGCACGGCTTTGCCTCTTTCTCTGATTATTATTATAAGTGGTCCTCGGCGGATTCCTGTAACATGAGTGGATTGATTACCATCGTGGTACTCCTTGGGATCGCCTTTGTAGTCTATAAGCTGTTCCTGAGTGACGGGCAGTATTCTCCTCCACCGTACTCTGAGTATCCTCCATTTTCCCACCGTTACCAGAGATTCACCAACTCAGCAGGACCTCCTCCCCCAGGCTTTAAGTCTGAGTTCACAGGACCACAGAATACTGGCCATGGTGCAACTTCTGGTTTTGGCAGTGCTTTTACAGGACAACAAGGATATGAAAATTCAGGACCAGGGTTCTGGACAGGCTTGGGAACTGGTGGAATACTAGGATATTTGTTTGGCAGCAATAGAGCGGCAACACCCTTCTCAGACTCGTGGTACTACCCGTCCTATCCTCCCTCCTACCCTGGCACGTGGAATAGGGCTTACTCACCCCTTCATGGAGGCTCGGGCAGCTATTCGGTATGTTCAAACTCAGACACGAAAACCAGAACTGCATCAGGATATGGTGGTACCAGGAGACGATAA
ORF Protein Sequence MAAACGPGAAGYCLLLGLHLFLLTAGPALGWNDPDRMLLRDVKALTLHYDRYTTSRRLDPIPQLKCVGGTAGCDSYTPKVIQCQNKGWDGYDVQWECKTDLDIAYKFGKTVVSCEGYESSEDQYVLRGSCGLEYNLDYTELGLQKLKESGKQHGFASFSDYYYKWSSADSCNMSGLITIVVLLGIAFVVYKLFLSDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2119-Ab Anti-SARAF monoclonal antibody
    Target Antigen GM-Tg-g-IP2119-Ag SARAF protein
    ORF Viral Vector pGMLP002260 Human SARAF Lentivirus plasmid
    ORF Viral Vector pGMAD000731 Human SARAF Adenovirus plasmid
    ORF Viral Vector vGMLP002260 Human SARAF Lentivirus particle
    ORF Viral Vector vGMAD000731 Human SARAF Adenovirus particle


    Target information

    Target ID GM-IP2119
    Target Name TMEM66/SARAF
    Gene Group Identifier
    (Target Gene ID in Homo species)
    51669
    Gene ID 100062785 (Equus caballus), 101089096 (Felis catus), 290796 (Rattus norvegicus), 482878 (Canis lupus familiaris)
    515461 (Bos taurus), 51669 (Homo sapiens), 67887 (Mus musculus), 693452 (Macaca mulatta)
    Gene Symbols & Synonyms SARAF,Saraf,TMEM66,Tmem66,XTP3,FOAP-7,HSPC035,1810045K07Rik
    Target Alternative Names TMEM66, SARAF,Store-operated calcium entry-associated regulatory factor,SARAF, SOCE-associated regulatory factor,HBV X-transactivated gene 3 protein, HBV XAg-transactivated protein 3, Protein FOAP-7, Transmembrane protein 66,XTP3,FOAP-7,TMEM66,HSPC035
    Uniprot Accession Q08E24,Q6AYN2,Q8R3Q0,Q96BY9
    Additional SwissProt Accessions: Q6AYN2,Q08E24,Q96BY9,Q8R3Q0
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000022913, ENSCAFG00845012775, ENSBTAG00000013579, ENSG00000133872, ENSMUSG00000031532, ENSMMUG00000014143
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.