Human TMEM215 ORF/cDNA clone-Adenovirus particle (NM_212558.2)

Cat. No.: vGMAD000723

Pre-made Human TMEM215/ Adenovirus for TMEM215 overexpression in-vitro and in-vivo. The TMEM215 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified TMEM215-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to TMEM215 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD000723 Human TMEM215 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD000723
Gene Name TMEM215
Accession Number NM_212558.2
Gene ID 401498
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 708 bp
Gene Alias
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Kanamycin
ORF Nucleotide Sequence ATGCGGCCTGATGACATTAACCCGAGGACTGGGCTGGTGGTGGCCCTGGTCAGTGTCTTCCTCGTCTTTGGTTTCATGTTCACCGTCTCTGGGATGAAAGGGGAGACTTTGGGAAACATCCCCCTCCTGGCCATCGGGCCAGCCATCTGCCTACCAGGCATCGCAGCCATTGCCCTGGCCAGGAAAACCGAGGGATGCACCAAGTGGCCAGAGAACGAGCTGCTGTGGGTCCGCAAATTGCCCTGCTTCCGGAAACCCAAAGACAAGGAGGTGGTAGAGCTGCTGAGGACCCCTTCAGACCTAGAATCCGGCAAGGGGAGCTCAGATGAGCTGGCTAAGAAGGCGGGCCTCAGGGGGAAGCCTCCCCCACAAAGCCAGGGTGAGGTGTCCGTGGCCAGCTCCATCAACAGCCCCACACCCACGGAGGAAGGAGAATGCCAGAGCCTCGTCCAGAATGGGCATCAGGAGGAGACGTCCAGATACCTGGACGGCTACTGCCCCTCGGGCAGTTCCCTCACCTACAGTGCCTTGGACGTCAAGTGCTCAGCAAGGGACAGATCTGAGTGCCCTGAGCCTGAGGATAGCATCTTCTTTGTGCCCCAGGACAGTATCATCGTTTGCTCCTACAAGCAGAACAGCCCGTATGACAGATACTGTTGTTATATCAATCAGATACAAGGCAGGTGGGACCACGAGACCATCGTCTAA
ORF Protein Sequence MRPDDINPRTGLVVALVSVFLVFGFMFTVSGMKGETLGNIPLLAIGPAICLPGIAAIALARKTEGCTKWPENELLWVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQSQGEVSVASSINSPTPTEEGECQSLVQNGHQEETSRYLDGYCPSGSSLTYSALDVKCSARDRSECPEPEDSIFFVPQDSIIVCSYKQNSPYDRYCCYINQIQGRWDHETIV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2049-Ab Anti-TMEM215 monoclonal antibody
    Target Antigen GM-Tg-g-IP2049-Ag TMEM215 protein
    ORF Viral Vector pGMLP003472 Human TMEM215 Lentivirus plasmid
    ORF Viral Vector pGMAD000411 Human TMEM215 Adenovirus plasmid
    ORF Viral Vector pGMAD000723 Human TMEM215 Adenovirus plasmid
    ORF Viral Vector vGMLP003472 Human TMEM215 Lentivirus particle
    ORF Viral Vector vGMAD000411 Human TMEM215 Adenovirus particle
    ORF Viral Vector vGMAD000723 Human TMEM215 Adenovirus particle


    Target information

    Target ID GM-IP2049
    Target Name TMEM215
    Gene Group Identifier
    (Target Gene ID in Homo species)
    401498
    Gene ID 100053699 (Equus caballus), 101097185 (Felis catus), 320500 (Mus musculus), 401498 (Homo sapiens)
    510133 (Bos taurus), 611763 (Canis lupus familiaris), 690918 (Rattus norvegicus), 704427 (Macaca mulatta)
    Gene Symbols & Synonyms TMEM215,Tmem215,A930001M12Rik
    Target Alternative Names A930001M12Rik,TMEM215,Tmem215,Transmembrane protein 215
    Uniprot Accession A7E1Z1,A7MB05,Q68D42
    Additional SwissProt Accessions: A7E1Z1,Q68D42,A7MB05
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000004732, ENSMUSG00000046593, ENSG00000188133, ENSBTAG00000013974, ENSCAFG00845019629, ENSMMUG00000053668
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.