Rat Cox7a2l ORF/cDNA clone-Adenovirus particle (NM_001106704.1)
Cat. No.: vGMAD000680
Pre-made Rat Cox7a2l/ Adenovirus for Cox7a2l overexpression in-vitro and in-vivo. The Cox7a2l adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified Cox7a2l-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAD000680 | Rat Cox7a2l Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAD000680 |
| Gene Name | Cox7a2l |
| Accession Number | NM_001106704.1 |
| Gene ID | 298762 |
| Species | Rat |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 363 bp |
| Gene Alias | |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Null |
| Fusion Tag | MYC (C-Terminal) |
| Promoter | CMV |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGGTCCGGCTTACTCGCGTCTCCTGGAATCCTTTCACGCAGGCTTGGAGCAGTCGCCGAGGTTTCTCTGTGTGTACGGCACCCTAGGCAAGGGTTTTAAGCCGGTTTCCAGAGAAGCACCGCCTATCATATTTGCCACACCGACCAAACTGACCTCCAGTGTGACAGCATATGACTATGCTGGGAAGAATAAAGTTCCAGAGCTACAGAGATTCTTCCAGAAGGCTGACGGTGTGCCCATCCACCTGAAACGAGGCCTTCCGGACCAAATGCTTTACCGGACCACCATGGCTCTCACAGTGGGAGGGACCATCTACTGCCTGATCGCCCTCTACATGGCCTCGAAGCCCAAAAACAAATGA |
| ORF Protein Sequence | MGPAYSRLLESFHAGLEQSPRFLCVYGTLGKGFKPVSREAPPIIFATPTKLTSSVTAYDYAGKNKVPELQRFFQKADGVPIHLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASKPKNK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| ORF Viral Vector | pGMAD000680 | Rat Cox7a2l Adenovirus plasmid |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.

