Human IFNG/IFG/IFI ORF/cDNA clone-Adenovirus particle (NM_000619.3)
Cat. No.: vGMAD000575
Pre-made Human IFNG/IFG/IFI Adenovirus for IFNG overexpression in-vitro and in-vivo. The IFNG adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified IFNG-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
IFN-gamma/IFNG/IFNG/IFG products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAD000575 | Human IFNG Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAD000575 |
| Gene Name | IFNG |
| Accession Number | NM_000619.3 |
| Gene ID | 3458 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 501 bp |
| Gene Alias | IFG,IFI |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAAATATACAAGTTATATCTTGGCTTTTCAGCTCTGCATCGTTTTGGGTTCTCTTGGCTGTTACTGCCAGGACCCATATGTAAAAGAAGCAGAAAACCTTAAGAAATATTTTAATGCAGGTCATTCAGATGTAGCGGATAATGGAACTCTTTTCTTAGGCATTTTGAAGAATTGGAAAGAGGAGAGTGACAGAAAAATAATGCAGAGCCAAATTGTCTCCTTTTACTTCAAACTTTTTAAAAACTTTAAAGATGACCAGAGCATCCAAAAGAGTGTGGAGACCATCAAGGAAGACATGAATGTCAAGTTTTTCAATAGCAACAAAAAGAAACGAGATGACTTCGAAAAGCTGACTAATTATTCGGTAACTGACTTGAATGTCCAACGCAAAGCAATACATGAACTCATCCAAGTGATGGCTGAACTGTCGCCAGCAGCTAAAACAGGGAAGCGAAAAAGGAGTCAGATGCTGTTTCGAGGTCGAAGAGCATCCCAGTAA |
| ORF Protein Sequence | MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-ab-175 | Pre-Made Emapalumab biosimilar, Whole mAb, Anti-IFNG Antibody: Anti-IFG/IFI/IMD69 therapeutic antibody |
| Biosimilar | GMP-Bios-ab-219 | Pre-Made Fontolizumab biosimilar, Whole mAb, Anti-IFNG Antibody: Anti-IFG/IFI/IMD69 therapeutic antibody |
| Target Antibody | GM-Tg-g-T77664-Ab | Anti-IFNG/ IFG/ IFI functional antibody |
| Target Antigen | GM-Tg-g-T77664-Ag | IFNG protein |
| Cytokine | cks-Tg-g-GM-T77664 | interferon, gamma (IFNG) protein & antibody |
| ORF Viral Vector | pGMLP000461 | Human IFNG Lentivirus plasmid |
| ORF Viral Vector | pGMAD000575 | Human IFNG Adenovirus plasmid |
| ORF Viral Vector | pGMAP000297 | Human IFNG Adenovirus plasmid |
| ORF Viral Vector | pGMPC004769 | Human IFNG Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000461 | Human IFNG Lentivirus particle |
| ORF Viral Vector | vGMAD000575 | Human IFNG Adenovirus particle |
| ORF Viral Vector | vGMAP000297 | Human IFNG Adenovirus particle |
Target information
| Target ID | GM-T77664 |
| Target Name | IFN-gamma/IFNG |
|
Gene Group Identifier (Target Gene ID in Homo species) |
3458 |
| Gene ID |
100034181 (Equus caballus), 15978 (Mus musculus), 25712 (Rattus norvegicus), 281237 (Bos taurus) 3458 (Homo sapiens), 403801 (Canis lupus familiaris), 493965 (Felis catus), 574282 (Macaca mulatta) |
| Gene Symbols & Synonyms | IFNG,Ifng,IF2F,Ifg,If2f,IFN-g,IFNG2,IFG,IFI,IMD69,IFN-G,IFN-gamma |
| Target Alternative Names | IF2F,IFG,IFI,IFN-G,IFN-g,IFN-gamma,IFNG,IFNG2,IMD69,If2f,Ifg,Ifng,Immune interferon,Interferon gamma |
| Uniprot Accession |
P01579,P01580,P01581,P07353,P42160,P42161,P46402,P63310
Additional SwissProt Accessions: P42160,P01580,P01581,P07353,P01579,P42161,P46402,P63310 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Diagnostics Biomarker, Immuno-oncology Target, INN Index, Cytokine Target |
| Disease | cancer, Breast Cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction, HIF-1 signaling pathway, TGF-beta signaling pathway, Osteoclast differentiation, Antigen processing and presentation, JAK-STAT signaling pathway, Natural killer cell mediated cytotoxicity, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Type I diabetes mellitus, Leishmaniasis, Chagas disease, African trypanosomiasis, Malaria, Toxoplasmosis, Amoebiasis, Tuberculosis, Hepatitis C, Influenza A, Pathways in cancer, PD-L1 expression and PD-1 checkpoint pathway in cancer, Inflammatory bowel disease, Rheumatoid arthritis, Allograft rejection, Graft-versus-host disease, Fluid shear stress and atherosclerosis |
| Gene Ensembl | ENSECAG00000028288, ENSMUSG00000055170, ENSBTAG00000012529, ENSG00000111537, ENSCAFG00845013680, ENSMMUG00000056408 |
| Target Classification | Cytokine Receptor, Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


