Human TNF/DIF/TNF-alpha ORF/cDNA clone-Adenovirus particle (NM_000594)
Cat. No.: vGMAD000416
Pre-made Human TNF/DIF/TNF-alpha Adenovirus for TNF overexpression in-vitro and in-vivo. The TNF adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified TNF-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
TNF-alpha/TNF/TNF/DIF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAD000416 | Human TNF Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAD000416 |
| Gene Name | TNF |
| Accession Number | NM_000594 |
| Gene ID | 7124 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 702 bp |
| Gene Alias | DIF,TNF-alpha,TNFA,TNFSF2,TNLG1F |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGCACTGAAAGCATGATCCGGGACGTGGAGCTGGCCGAGGAGGCGCTCCCCAAGAAGACAGGGGGGCCCCAGGGCTCCAGGCGGTGCTTGTTCCTCAGCCTCTTCTCCTTCCTGATCGTGGCAGGCGCCACCACGCTCTTCTGCCTGCTGCACTTTGGAGTGATCGGCCCCCAGAGGGAAGAGTTCCCCAGGGACCTCTCTCTAATCAGCCCTCTGGCCCAGGCAGTCAGATCATCTTCTCGAACCCCGAGTGACAAGCCTGTAGCCCATGTTGTAGCAAACCCTCAAGCTGAGGGGCAGCTCCAGTGGCTGAACCGCCGGGCCAATGCCCTCCTGGCCAATGGCGTGGAGCTGAGAGATAACCAGCTGGTGGTGCCATCAGAGGGCCTGTACCTCATCTACTCCCAGGTCCTCTTCAAGGGCCAAGGCTGCCCCTCCACCCATGTGCTCCTCACCCACACCATCAGCCGCATCGCCGTCTCCTACCAGACCAAGGTCAACCTCCTCTCTGCCATCAAGAGCCCCTGCCAGAGGGAGACCCCAGAGGGGGCTGAGGCCAAGCCCTGGTATGAGCCCATCTATCTGGGAGGGGTCTTCCAGCTGGAGAAGGGTGACCGACTCAGCGCTGAGATCAATCGGCCCGACTATCTCGACTTTGCCGAGTCTGGGCAGGTCTACTTTGGGATCATTGCCCTGTGA |
| ORF Protein Sequence | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Target information
| Target ID | GM-T20178 |
| Target Name | TNF-alpha/TNF |
|
Gene Group Identifier (Target Gene ID in Homo species) |
7124 |
| Gene ID |
100033834 (Equus caballus), 21926 (Mus musculus), 24835 (Rattus norvegicus), 280943 (Bos taurus) 403922 (Canis lupus familiaris), 493755 (Felis catus), 7124 (Homo sapiens), 715467 (Macaca mulatta) |
| Gene Symbols & Synonyms | TNF,Tnf,TNFA,TNF-a,TNFSF2,TNLG1F,TNF-alpha,DIF,Tnfa,Tnlg1f,Tnfsf1a,TNFalpha,RATTNF,TNFa,cTNF,IMD127,TNF-ALPHA |
| Target Alternative Names | Cachectin,DIF,IMD127,RATTNF,TNF,TNF-ALPHA,TNF-a,TNF-alpha,TNFA,TNFSF2,TNFa,TNFalpha,TNLG1F,Tnf,Tnfa,Tnfsf1a,Tnlg1f,Tumor necrosis factor,Tumor necrosis factor ligand superfamily member 2 (TNF-a),cTNF |
| Uniprot Accession |
P01375,P06804,P16599,P19101,P29553,P48094,P51742,Q06599
Additional SwissProt Accessions: P29553,P06804,P16599,Q06599,P51742,P19101,P01375,P48094 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Diagnostics Biomarker, Immuno-oncology Target, INN Index, Cytokine Target |
| Disease | cancer, Ovary Cancer, toluene diisocyanate asthma, Giant Cell Arteritis, Polymyalgia Rheumatica, Chronic Kidney Disease, Dent disease, Hodgkin's disease, Kidney transplant rejection, pancreatic cancer, Chronic Glomerulonephritis, Asthma |
| Disease from KEGG | Antifolate resistance, MAPK signaling pathway, Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, NF-kappa B signaling pathway, Sphingolipid signaling pathway, Apoptosis, TGF-beta signaling pathway, Osteoclast differentiation, Antigen processing and presentation, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, C-type lectin receptor signaling pathway, Hematopoietic cell lineage, Natural killer cell mediated cytotoxicity, IL-17 signaling pathway, T cell receptor signaling pathway, Fc epsilon RI signaling pathway, TNF signaling pathway, Adipocytokine signaling pathway, Type II diabetes mellitus, Insulin resistance, AGE-RAGE signaling pathway in diabetic complications, Alcoholic liver disease, Type I diabetes mellitus, Alzheimer disease, Pathogenic Escherichia coli infection, Pertussis, Legionellosis, Yersinia infection, Leishmaniasis, Chagas disease, African trypanosomiasis, Malaria, Toxoplasmosis, Amoebiasis, Tuberculosis, Hepatitis C, Hepatitis B, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Human T-cell leukemia virus 1 infection, Epstein-Barr virus infection, Proteoglycans in cancer, Asthma, Inflammatory bowel disease, Rheumatoid arthritis, Allograft rejection, Graft-versus-host disease, Hypertrophic cardiomyopathy, Dilated cardiomyopathy, Lipid and atherosclerosis, Fluid shear stress and atherosclerosis |
| Gene Ensembl | ENSECAG00000001174, ENSMUSG00000024401, ENSCAFG00845010558, ENSG00000232810, ENSMMUG00000045654 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


