Human FGF2/BFGF/FGF-2 ORF/cDNA clone-Adenovirus particle (NM_002006)
Cat. No.: vGMAD000136
Pre-made Human FGF2/BFGF/FGF-2 Adenovirus for FGF2 overexpression in-vitro and in-vivo. The FGF2 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified FGF2-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
FGF2/BFGF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAD000136 | Human FGF2 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAD000136 |
Gene Name | FGF2 |
Accession Number | NM_002006 |
Gene ID | 2247 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 867 bp |
Gene Alias | BFGF,FGF-2,FGFB,HBGF-2 |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | CTGGTGGGTGTGGGGGGTGGAGATGTAGAAGATGTGACGCCGCGGCCCGGCGGGTGCCAGATTAGCGGACGCGGTGCCCGCGGTTGCAACGGGATCCCGGGCGCTGCAGCTTGGGAGGCGGCTCTCCCCAGGCGGCGTCCGCGGAGACACCCATCCGTGAACCCCAGGTCCCGGGCCGCCGGCTCGCCGCGCACCAGGGGCCGGCGGACAGAAGAGCGGCCGAGCGGCTCGAGGCTGGGGGACCGCGGGCGCGGCCGCGCGCTGCCGGGCGGGAGGCTGGGGGGCCGGGGCCGGGGCCGTGCCCCGGAGCGGGTCGGAGGCCGGGGCCGGGGCCGGGGGACGGCGGCTCCCCGCGCGGCTCCAGCGGCTCGGGGATCCCGGCCGGGCCCCGCAGGGACCATGGCAGCCGGGAGCATCACCACGCTGCCCGCCTTGCCCGAGGATGGCGGCAGCGGCGCCTTCCCGCCCGGCCACTTCAAGGACCCCAAGCGGCTGTACTGCAAAAACGGGGGCTTCTTCCTGCGCATCCACCCCGACGGCCGAGTTGACGGGGTCCGGGAGAAGAGCGACCCTCACATCAAGCTACAACTTCAAGCAGAAGAGAGAGGAGTTGTGTCTATCAAAGGAGTGTGTGCTAACCGTTACCTGGCTATGAAGGAAGATGGAAGATTACTGGCTTCTAAATGTGTTACGGATGAGTGTTTCTTTTTTGAACGATTGGAATCTAATAACTACAATACTTACCGGTCAAGGAAATACACCAGTTGGTATGTGGCACTGAAACGAACTGGGCAGTATAAACTTGGATCCAAAACAGGACCTGGGCAGAAAGCTATACTTTTTCTTCCAATGTCTGCTAAGAGCTGA |
ORF Protein Sequence | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-INN-820 | Pre-Made Eflimrufusp Alfa Biosimilar, Fusion Protein targeting FGF2 fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting BFGF/FGF-2/FGFB/HBGF-2 |
Biosimilar | GMP-Bios-INN-969 | Pre-Made Recifercept biosimilar, Recombinant Protein: Recombinant therapeutic protein targeting FGF |
Target Antibody | GM-Tg-g-T31621-Ab | Anti-FGF2/ BFGF/ FGF-2 functional antibody |
Target Antigen | GM-Tg-g-T31621-Ag | FGF2 protein |
Cytokine | cks-Tg-g-GM-T31621 | fibroblast growth factor 2 (basic) (FGF2) protein & antibody |
ORF Viral Vector | pGMLV000801 | Human FGF2 Lentivirus plasmid |
ORF Viral Vector | pGMAD000136 | Human FGF2 Adenovirus plasmid |
ORF Viral Vector | vGMLV000801 | Human FGF2 Lentivirus particle |
ORF Viral Vector | vGMAD000136 | Human FGF2 Adenovirus particle |
Target information
Target ID | GM-T31621 |
Target Name | FGF2 |
Gene Group Identifier (Target Gene ID in Homo species) |
2247 |
Gene ID |
100033955 (Equus caballus), 100135772 (Felis catus), 14173 (Mus musculus), 2247 (Homo sapiens) 281161 (Bos taurus), 403857 (Canis lupus familiaris), 54250 (Rattus norvegicus), 574136 (Macaca mulatta) |
Gene Symbols & Synonyms | FGF2,Fgf2,Fgfb,bFGF,Fgf-2,Fgf2a,BFGF,FGFB,FGF-2,HBGF-2 |
Target Alternative Names | FGF2,Fibroblast growth factor 2,FGF-2,Basic fibroblast growth factor (bFGF), Heparin-binding growth factor 2 (HBGF-2),BFGF,FGFB,FGF-2,HBGF-2 |
Uniprot Accession |
P03969,P09038,P13109,P15655
Additional SwissProt Accessions: P15655,P09038,P03969,P13109 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target |
Disease | cancer, Breast Cancer |
Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Signaling pathways regulating pluripotency of stem cells, Regulation of actin cytoskeleton, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer, Proteoglycans in cancer, Chemical carcinogenesis - receptor activation, Melanoma, Breast cancer, Gastric cancer |
Gene Ensembl | ENSMUSG00000037225, ENSG00000138685 |
Target Classification | Checkpoint-Immuno Oncology |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.