Human CSNK2A2/CK2A2/CK2alpha' ORF/cDNA clone-Adenovirus particle (NM_001896.2)

Cat. No.: vGMAD000128

Pre-made Human CSNK2A2/CK2A2/CK2alpha' Adenovirus for CSNK2A2 overexpression in-vitro and in-vivo. The CSNK2A2 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CSNK2A2-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to CSNK2A2/CK2A2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD000128 Human CSNK2A2 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD000128
Gene Name CSNK2A2
Accession Number NM_001896.2
Gene ID 1459
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 1053 bp
Gene Alias CK2A2,CK2alpha',CSNK2A1
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 6xHis (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCCCGGCCCGGCCGCGGGCAGCAGGGCCCGGGTCTACGCCGAGGTGAACAGTCTGAGGAGCCGCGAGTACTGGGACTACGAGGCTCACGTCCCGAGCTGGGGTAATCAAGATGATTACCAACTGGTTCGAAAACTTGGTCGGGGAAAATATAGTGAAGTATTTGAGGCCATTAATATCACCAACAATGAGAGAGTGGTTGTAAAAATCCTGAAGCCAGTGAAGAAAAAGAAGATAAAACGAGAGGTTAAGATTCTGGAGAACCTTCGTGGTGGAACAAATATCATTAAGCTGATTGACACTGTAAAGGACCCCGTGTCAAAGACACCAGCTTTGGTATTTGAATATATCAATAATACAGATTTTAAGCAACTCTACCAGATCCTGACAGACTTTGATATCCGGTTTTATATGTATGAACTACTTAAAGCTCTGGATTACTGCCACAGCAAGGGAATCATGCACAGGGATGTGAAACCTCACAATGTCATGATAGATCACCAACAGAAAAAGCTGCGACTGATAGATTGGGGTCTGGCAGAATTCTATCATCCTGCTCAGGAGTACAATGTTCGTGTAGCCTCAAGGTACTTCAAGGGACCAGAGCTCCTCGTGGACTATCAGATGTATGATTATAGCTTGGACATGTGGAGTTTGGGCTGTATGTTAGCAAGCATGATCTTTCGAAGGGAACCATTCTTCCATGGACAGGACAACTATGACCAGCTTGTTCGCATTGCCAAGGTTCTGGGTACAGAAGAACTGTATGGGTATCTGAAGAAGTATCACATAGACCTAGATCCACACTTCAACGATATCCTGGGACAACATTCACGGAAACGCTGGGAAAACTTTATCCATAGTGAGAACAGACACCTTGTCAGCCCTGAGGCCCTAGATCTTCTGGACAAACTTCTGCGATACGACCATCAACAGAGACTGACTGCCAAAGAGGCCATGGAGCACCCATACTTCTACCCTGTGGTGAAGGAGCAGTCCCAGCCTTGTGCAGACAATGCTGTGCTTTCCAGTGGTCTCACGGCAGCACGATGA
ORF Protein Sequence MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T80526-Ab Anti-CSNK2A2 monoclonal antibody
    Target Antigen GM-Tg-g-T80526-Ag CSNK2A2 protein
    ORF Viral Vector pGMLP004104 Human CSNK2A2 Lentivirus plasmid
    ORF Viral Vector pGMAD000128 Human CSNK2A2 Adenovirus plasmid
    ORF Viral Vector pGMLPm004017 Human CSNK2A2 Lentivirus plasmid
    ORF Viral Vector pGMLP-SPh-144 Human CSNK2A2 Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-295 Human CSNK2A2 Adenovirus plasmid
    ORF Viral Vector vGMLP004104 Human CSNK2A2 Lentivirus particle
    ORF Viral Vector vGMAD000128 Human CSNK2A2 Adenovirus particle
    ORF Viral Vector vGMLPm004017 Human CSNK2A2 Lentivirus particle
    ORF Viral Vector vGMLP-SPh-144 Human CSNK2A2 Lentivirus particle
    ORF Viral Vector vGMAP-SPh-295 Human CSNK2A2 Adenovirus particle


    Target information

    Target ID GM-T80526
    Target Name CSNK2A2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    1459
    Gene ID 100063080 (Equus caballus), 101093065 (Felis catus), 13000 (Mus musculus), 1459 (Homo sapiens)
    282420 (Bos taurus), 307641 (Rattus norvegicus), 478108 (Canis lupus familiaris), 712455 (Macaca mulatta)
    Gene Symbols & Synonyms CSNK2A2,Csnk2a2,CK2,1110035J23Rik,CK2A2,CSNK2A1,CK2alpha'
    Target Alternative Names CSNK2A2,Casein kinase II subunit alpha',CK II alpha',CK2A2,CSNK2A1,CK2alpha'
    Uniprot Accession O54833,P19784,P20427
    Additional SwissProt Accessions: O54833,P19784,P20427
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG NF-kappa B signaling pathway, Wnt signaling pathway, Adherens junction, Alzheimer disease, Measles, PD-L1 expression and PD-1 checkpoint pathway in cancer
    Gene Ensembl ENSECAG00000014130, ENSMUSG00000046707, ENSG00000070770, ENSBTAG00000013784, ENSCAFG00845002309, ENSMMUG00000015892
    Target Classification Kinase


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.