Human BAX/BCL2L4 ORF/cDNA clone-Adenovirus particle (NM_001291428.1)

Cat. No.: vGMAD000113

Pre-made Human BAX/BCL2L4 Adenovirus for BAX overexpression in-vitro and in-vivo. The BAX adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified BAX-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to BAX/BCL2L4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD000113 Human BAX Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD000113
Gene Name BAX
Accession Number NM_001291428.1
Gene ID 581
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 666 bp
Gene Alias BCL2L4
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag HA (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACGGGTCCGGGGAGCAGCCCAGAGGCGGGGGGCCCACCAGCTCTGAGCAGATCATGAAGACAGGGGCCCTTTTGCTTCAGGGTTTCATCCAGGATCGAGCAGGGCGAATGGGGGGGGAGGCACCCGAGCTGGCCCTGGACCCGGTGCCTCAGGATGCGTCCACCAAGAAGCTGAGCGAGTGTCTCAAGCGCATCGGGGACGAACTGGACAGTAACATGGAGCTGCAGAGGATGATTGCCGCCGTGGACACAGACTCCCCCCGAGAGGTCTTTTTCCGAGTGGCAGCTGACATGTTTTCTGACGGCAACTTCAACTGGGGCCGGGTTGTCGCCCTTTTCTACTTTGCCAGCAAACTGGTGCTCAAGGCCCTGTGCACCAAGGTGCCGGAACTGATCAGAACCATCATGGGCTGGACATTGGACTTCCTCCGGGAGCGGCTGTTGGGCTGGATCCAAGACCAGGGTGGTTGGGGGCTGCCCCTGGCCGAGTCACTGAAGCGACTGATGTCCCTGTCTCCAGGACGGCCTCCTCTCCTACTTTGGGACGCCCACGTGGCAGACCGTGACCATCTTTGTGGCGGGAGTGCTCACCGCCTCACTCACCATCTGGAAGAAGATGGGCTGAGGCCCCCAGCTGCCTTGGACTGTGTTTTTCCTCCATAA
ORF Protein Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWGLPLAESLKRLMSLSPGRPPLLLWDAHVADRDHLCGGSAHRLTHHLEEDGLRPPAALDCVFPP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0034-Ab Anti-BAX monoclonal antibody
    Target Antigen GM-Tg-g-IP0034-Ag BAX protein
    ORF Viral Vector pGMAD000113 Human BAX Adenovirus plasmid
    ORF Viral Vector pGMAP000055 Human BAX Adenovirus plasmid
    ORF Viral Vector pGMLP-SPh-015 Human BAX Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-155 Human BAX Adenovirus plasmid
    ORF Viral Vector vGMAD000113 Human BAX Adenovirus particle
    ORF Viral Vector vGMAP000055 Human BAX Adenovirus particle
    ORF Viral Vector vGMLP-SPh-015 Human BAX Lentivirus particle
    ORF Viral Vector vGMAP-SPh-155 Human BAX Adenovirus particle


    Target information

    Target ID GM-IP0034
    Target Name BAX
    Gene Group Identifier
    (Target Gene ID in Homo species)
    581
    Gene ID 100054674 (Equus caballus), 12028 (Mus musculus), 24887 (Rattus norvegicus), 280730 (Bos taurus)
    403523 (Canis lupus familiaris), 493837 (Felis catus), 581 (Homo sapiens), 718948 (Macaca mulatta)
    Gene Symbols & Synonyms BAX,Bax,BCL2L4
    Target Alternative Names Apoptosis regulator BAX,BAX,BCL2L4,Bax,Bcl-2-like protein 4 (Bcl2-L-4)
    Uniprot Accession O02703,Q07812,Q07813,Q63690
    Additional SwissProt Accessions: Q07813,Q63690,O02703,Q07812
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG EGFR tyrosine kinase inhibitor resistance, Endocrine resistance, Sphingolipid signaling pathway, p53 signaling pathway, Protein processing in endoplasmic reticulum, Apoptosis, Longevity regulating pathway, Apoptosis - multiple species, Neurotrophin signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Pathogenic Escherichia coli infection, Tuberculosis, Hepatitis C, Hepatitis B, Measles, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Pathways in cancer, Colorectal cancer, Pancreatic cancer, Endometrial cancer, Glioma, Thyroid cancer, Basal cell carcinoma, Melanoma, Chronic myeloid leukemia, Small cell lung cancer, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma, Gastric cancer, Lipid and atherosclerosis
    Gene Ensembl ENSECAG00000016635, ENSMUSG00000003873, ENSBTAG00000013340, ENSCAFG00845000500, ENSG00000087088, ENSMMUG00000003907
    Target Classification Pathway, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.