Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected] -
Talk to our sales:
[email protected]
Protocol Library Download
 |
 |
Human SNCA/NACP/PARK1 ORF/cDNA clone-Adenovirus particle (NM_000345.3)
Cat. No.: vGMAD000007
Pre-made Human SNCA/NACP/PARK1 Adenovirus for SNCA overexpression in-vitro and in-vivo. The SNCA adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified SNCA-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
Alpha Synuclein/SNCA/SNCA/NACP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAD000007 | Human SNCA Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAD000007 |
| Gene Name | SNCA |
| Accession Number | NM_000345.3 |
| Gene ID | 6622 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 423 bp |
| Gene Alias | NACP,PARK1,PARK4,PD1 |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGATGTATTCATGAAAGGACTTTCAAAGGCCAAGGAGGGAGTTGTGGCTGCTGCTGAGAAAACCAAACAGGGTGTGGCAGAAGCAGCAGGAAAGACAAAAGAGGGTGTTCTCTATGTAGGCTCCAAAACCAAGGAGGGAGTGGTGCATGGTGTGGCAACAGTGGCTGAGAAGACCAAAGAGCAAGTGACAAATGTTGGAGGAGCAGTGGTGACGGGTGTGACAGCAGTAGCCCAGAAGACAGTGGAGGGAGCAGGGAGCATTGCAGCAGCCACTGGCTTTGTCAAAAAGGACCAGTTGGGCAAGAATGAAGAAGGAGCCCCACAGGAAGGAATTCTGGAAGATATGCCTGTGGATCCTGACAATGAGGCTTATGAAATGCCTTCTGAGGAAGGGTATCAAGACTACGAACCTGAAGCCTAA |
| ORF Protein Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Target information
| Target ID | GM-T03644 |
| Target Name | Alpha Synuclein/SNCA |
|
Gene Group Identifier （Target Gene ID in Homo species) |
6622 |
| Gene ID |
100053270 (Equus caballus), 101091694 (Felis catus), 20617 (Mus musculus), 282857 (Bos taurus) 29219 (Rattus norvegicus), 478478 (Canis lupus familiaris), 6622 (Homo sapiens), 706985 (Macaca mulatta) |
| Gene Symbols & Synonyms | SNCA,Snca,NACP,alphaSYN,alpha-Syn,PD1,PARK1,PARK4 |
| Target Alternative Names | Alpha Synuclein, SNCA,Alpha-synuclein,Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor (NACP),PD1,NACP,PARK1,PARK4 |
| Uniprot Accession |
O55042,P37377,P37840,P61143,Q3T0G8
Additional SwissProt Accessions: O55042,Q3T0G8,P37377,P37840,P61143 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Diagnostics Biomarker, INN Index |
| Disease | |
| Disease from KEGG | Alzheimer disease |
| Gene Ensembl | ENSECAG00000015766, ENSMUSG00000025889, ENSBTAG00000024957, ENSCAFG00845019506, ENSG00000145335, ENSMMUG00000012123 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.