Human IGF1/IGF/IGF-I ORF/cDNA clone-Adeno-associate virus(AAV) particle (NM_000618.5)

Cat. No.: vGMAAV001559

Pre-made Human IGF1/IGF/IGF-I Adeno-associated virus particle for IGF1 in-vivo study, mechanism of action (MOA) research and IGF1-associated gene therapy development.

At GM Vector Core (GMVC), we stand at the forefront of custom AAV development and produce distinct grades of AAVs employing state-of-the-art methodologies. Uncover more about our expertise.

Target products collection

Go to IGF1/IGF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name AAV serotype AAV Grade AAV quantity
vGMAAV001559 Human IGF1 Adeno-associate virus(AAV) particle AAV1, AAV2, AAV2 variant (Y444F), AAV2 variant (Y272F, Y444F, Y500F, Y730F), AAV2 variant (Y444F, Y730F, Y500F, Y272F, Y704F, Y252F), AAV2 variant(AAV2.7m8), AAV5, AAV6, AAV8, AAV8-1m, AAV8-2m, AAV8 variant (Y733F, Y447F, Y275), AAV9, AAV-Rh.10, AAV-DJ, AAV-DJ/8, AAV-Retro (Retrograde), AAV9-PHP.B, AAV9-PHP.eB, AAV9-PHP.S, AAV-BR1, AAV-2i8, AAV-SIG, AAV-VEC, AAV4, AAV6.2, AAV6.2FF Pilot Grade 1.0E+12VG/ml
5.0E+12VG/ml
1E+13VG/ml
5E+13VG/ml
1E+14VG/ml
Research Grade 1.0E+12VG/ml
5.0E+12VG/ml
1E+13VG/ml
5E+13VG/ml
1E+14VG/ml
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAAV001559
Gene Name IGF1
Accession Number NM_000618.5
Gene ID 3479
Species Human
Product Type Adeno-associate virus(AAV) particle (overexpression)
Insert Length 462 bp
Gene Alias IGF,IGF-I,IGFI,MGF
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter TBG
Resistance Amplicin
ORF Nucleotide Sequence ATGGGAAAAATCAGCAGTCTTCCAACCCAATTATTTAAGTGCTGCTTTTGTGATTTCTTGAAGGTGAAGATGCACACCATGTCCTCCTCGCATCTCTTCTACCTGGCGCTGTGCCTGCTCACCTTCACCAGCTCTGCCACGGCTGGACCGGAGACGCTCTGCGGGGCTGAGCTGGTGGATGCTCTTCAGTTCGTGTGTGGAGACAGGGGCTTTTATTTCAACAAGCCCACAGGGTATGGCTCCAGCAGTCGGAGGGCGCCTCAGACAGGCATCGTGGATGAGTGCTGCTTCCGGAGCTGTGATCTAAGGAGGCTGGAGATGTATTGCGCACCCCTCAAGCCTGCCAAGTCAGCTCGCTCTGTCCGTGCCCAGCGCCACACCGACATGCCCAAGACCCAGAAGGAAGTACATTTGAAGAACGCAAGTAGAGGGAGTGCAGGAAACAAGAACTACAGGATGTAG
ORF Protein Sequence MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-634 Pre-Made Xentuzumab biosimilar, Whole mAb, Anti-IGF1;IGF2 Antibody: Anti-IGF/IGF-I/IGFI/MGF;C11orf43/GRDF/IGF-II/PP9974/SRS3 therapeutic antibody
    Biosimilar GMP-Bios-ab-160 Pre-Made Dusigitumab biosimilar, Whole mAb, Anti-IGF1;IGF2 Antibody: Anti-IGF/IGF-I/IGFI/MGF;C11orf43/GRDF/IGF-II/PP9974/SRS3 therapeutic antibody
    Target Antibody GM-Tg-g-T60930-Ab Anti-IGF1/ IGF/ IGF-I functional antibody
    Target Antigen GM-Tg-g-T60930-Ag IGF1 protein
    Cytokine cks-Tg-g-GM-T60930 insulin-like growth factor 1 (IGF1) protein & antibody
    ORF Viral Vector pGMLP003306 Human IGF1 Lentivirus plasmid
    ORF Viral Vector pGMLV000664 Human IGF-1 Lentivirus plasmid
    ORF Viral Vector pGMAD000056 Human IGF1 Adenovirus plasmid
    ORF Viral Vector pGMAAV001559 Human IGF1 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLP003306 Human IGF1 Lentivirus particle
    ORF Viral Vector vGMLV000664 Human IGF-1 Lentivirus particle
    ORF Viral Vector vGMAD000056 Human IGF1 Adenovirus particle
    ORF Viral Vector vGMAAV001559 Human IGF1 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T60930
    Target Name IGF1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3479
    Gene ID 100034198 (Equus caballus), 101101237 (Felis catus), 16000 (Mus musculus), 24482 (Rattus norvegicus)
    281239 (Bos taurus), 3479 (Homo sapiens), 610255 (Canis lupus familiaris), 698444 (Macaca mulatta)
    Gene Symbols & Synonyms IGF1,Igf1,Igf-1,Igf-I,C730016P09Rik,IGF,IGF-1,IGF-I,MGF,IGFI,IGFIA
    Target Alternative Names C730016P09Rik,IGF,IGF-1,IGF-I,IGF1,IGFI,IGFIA,Igf-1,Igf-I,Igf1,Insulin-like growth factor 1,Insulin-like growth factor I (IGF-I),MGF,Mechano growth factor (MGF),Somatomedin-C
    Uniprot Accession P05017,P05019,P07455,P08025,P33712,P51458
    Additional SwissProt Accessions: P51458,P05017,P08025,P07455,P05019,P33712
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index, Cytokine Target
    Disease cancer, Prostate Cancer
    Disease from KEGG EGFR tyrosine kinase inhibitor resistance, Endocrine resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, HIF-1 signaling pathway, FoxO signaling pathway, p53 signaling pathway, PI3K-Akt signaling pathway, Longevity regulating pathway, Longevity regulating pathway - multiple species, Focal adhesion, Signaling pathways regulating pluripotency of stem cells, Inflammatory mediator regulation of TRP channels, Ovarian steroidogenesis, Growth hormone synthesis, secretion and action, Aldosterone-regulated sodium reabsorption, Pathways in cancer, Proteoglycans in cancer, Glioma, Prostate cancer, Melanoma, Breast cancer, Hypertrophic cardiomyopathy, Dilated cardiomyopathy
    Gene Ensembl ENSECAG00000010109, ENSMUSG00000020053, ENSBTAG00000011082, ENSG00000017427, ENSCAFG00845009366, ENSMMUG00000002235
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.