Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human CCL20/CKb4/Exodus ORF/cDNA clone-Adeno-associate virus(AAV) particle (NM_001130046.2)
Cat. No.: vGMAAV000788
Pre-made Human CCL20/CKb4/Exodus Adeno-associated virus particle for CCL20 in-vivo study, mechanism of action (MOA) research and CCL20-associated gene therapy development.
At GM Vector Core (GMVC), we stand at the forefront of custom AAV development and produce distinct grades of AAVs employing state-of-the-art methodologies. Uncover more about our expertise.
Go to
CCL20/MIP-3 alpha/CCL20/CKb4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | AAV serotype | AAV Grade | AAV quantity |
| vGMAAV000788 | Human CCL20 Adeno-associate virus(AAV) particle | AAV1, AAV2, AAV2 variant (Y444F), AAV2 variant (Y272F, Y444F, Y500F, Y730F), AAV2 variant (Y444F, Y730F, Y500F, Y272F, Y704F, Y252F), AAV2 variant(AAV2.7m8), AAV5, AAV6, AAV8, AAV8-1m, AAV8-2m, AAV8 variant (Y733F, Y447F, Y275), AAV9, AAV-Rh.10, AAV-DJ, AAV-DJ/8, AAV-Retro (Retrograde), AAV9-PHP.B, AAV9-PHP.eB, AAV9-PHP.S, AAV-BR1, AAV-2i8, AAV-SIG, AAV-VEC, AAV4, AAV6.2, AAV6.2FF | Pilot Grade | 1.0E+12VG/ml |
| 5.0E+12VG/ml | ||||
| 1E+13VG/ml | ||||
| 5E+13VG/ml | ||||
| 1E+14VG/ml | ||||
| Research Grade | 1.0E+12VG/ml | |||
| 5.0E+12VG/ml | ||||
| 1E+13VG/ml | ||||
| 5E+13VG/ml | ||||
| 1E+14VG/ml | ||||
| GMP-like Grade | inquiry | |||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAAV000788 |
| Gene Name | CCL20 |
| Accession Number | NM_001130046.2 |
| Gene ID | 6364 |
| Species | Human |
| Product Type | Adeno-associate virus(AAV) particle (overexpression) |
| Insert Length | 288 bp |
| Gene Alias | CKb4,Exodus,LARC,MIP-3-alpha,MIP-3a,MIP3A,SCYA20,ST38 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTGCTGTACCAAGAGTTTGCTCCTGGCTGCTTTGATGTCAGTGCTGCTACTCCACCTCTGCGGCGAATCAGAAGCAAGCAACTTTGACTGCTGTCTTGGATACACAGACCGTATTCTTCATCCTAAATTTATTGTGGGCTTCACACGGCAGCTGGCCAATGAAGGCTGTGACATCAATGCTATCATCTTTCACACAAAGAAAAAGTTGTCTGTGTGCGCAAATCCAAAACAGACTTGGGTGAAATATATTGTGCGTCTCCTCAGTAAAAAAGTCAAGAACATGTAA |
| ORF Protein Sequence | MCCTKSLLLAALMSVLLLHLCGESEASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T04894-Ab | Anti-CCL20/ CKb4/ Exodus functional antibody |
| Target Antigen | GM-Tg-g-T04894-Ag | CCL20 protein |
| Cytokine | cks-Tg-g-GM-T04894 | chemokine (C-C motif) ligand 20 (CCL20) protein & antibody |
| ORF Viral Vector | pGMLV000235 | Human CCL20 Lentivirus plasmid |
| ORF Viral Vector | pGMAAV000788 | Human CCL20 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | vGMLV000235 | Human CCL20 Lentivirus particle |
| ORF Viral Vector | vGMAAV000788 | Human CCL20 Adeno-associate virus(AAV) particle |
Target information
| Target ID | GM-T04894 |
| Target Name | CCL20/MIP-3 alpha |
|
Gene Group Identifier （Target Gene ID in Homo species) |
6364 |
| Gene ID |
100629808 (Equus caballus), 101089032 (Felis catus), 20297 (Mus musculus), 281666 (Bos taurus) 29538 (Rattus norvegicus), 448790 (Canis lupus familiaris), 574182 (Macaca mulatta), 6364 (Homo sapiens) |
| Gene Symbols & Synonyms | CCL20,Ccl20,CKb4,LARC,ST38,MIP3A,MIP-3A,Scya20,MIP-3[a],exodus-1,Exodus,MIP-3a,SCYA20,MIP-3-alpha |
| Target Alternative Names | Beta-chemokine exodus-1,C-C motif chemokine 20,CC chemokine LARC,CCL20,CKb4,Ccl20,Exodus,LARC,Liver and activation-regulated chemokine,MIP-3 alpha,MIP-3-alpha,MIP-3A,MIP-3[a],MIP-3a,MIP3A,Macrophage inflammatory protein 3 alpha (MIP-3-alpha),SCYA20,ST38,Scya20,Small-inducible cytokine A20,exodus-1 |
| Uniprot Accession |
O89093,P78556,P97884,Q8SQB1
Additional SwissProt Accessions: O89093,Q8SQB1,P97884,P78556 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Immuno-oncology Target, Cytokine Target |
| Disease | cancer, Prostate Cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, IL-17 signaling pathway, TNF signaling pathway, Rheumatoid arthritis |
| Gene Ensembl | ENSMUSG00000026166, ENSBTAG00000021326, ENSCAFG00845017158, ENSMMUG00000013250, ENSG00000115009 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.