Human VEGFA/MVCD1/VEGF ORF/cDNA clone-Adeno-associate virus(AAV) particle (NM_001171626.1)

Cat. No.: vGMAAV000786

Pre-made Human VEGFA/MVCD1/VEGF Adeno-associated virus particle for VEGFA in-vivo study, mechanism of action (MOA) research and VEGFA-associated gene therapy development.

At GM Vector Core (GMVC), we stand at the forefront of custom AAV development and produce distinct grades of AAVs employing state-of-the-art methodologies. Uncover more about our expertise.

Target products collection

Go to VEGFA/MVCD1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name AAV serotype AAV Grade AAV quantity
vGMAAV000786 Human VEGFA Adeno-associate virus(AAV) particle AAV1, AAV2, AAV2 variant (Y444F), AAV2 variant (Y272F, Y444F, Y500F, Y730F), AAV2 variant (Y444F, Y730F, Y500F, Y272F, Y704F, Y252F), AAV2 variant(AAV2.7m8), AAV5, AAV6, AAV8, AAV8-1m, AAV8-2m, AAV8 variant (Y733F, Y447F, Y275), AAV9, AAV-Rh.10, AAV-DJ, AAV-DJ/8, AAV-Retro (Retrograde), AAV9-PHP.B, AAV9-PHP.eB, AAV9-PHP.S, AAV-BR1, AAV-2i8, AAV-SIG, AAV-VEC, AAV4, AAV6.2, AAV6.2FF Pilot Grade 1.0E+12VG/ml
5.0E+12VG/ml
1E+13VG/ml
5E+13VG/ml
1E+14VG/ml
Research Grade 1.0E+12VG/ml
5.0E+12VG/ml
1E+13VG/ml
5E+13VG/ml
1E+14VG/ml
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAAV000786
Gene Name VEGFA
Accession Number NM_001171626.1
Gene ID 7422
Species Human
Product Type Adeno-associate virus(AAV) particle (overexpression)
Insert Length 576 bp
Gene Alias MVCD1,VEGF,VPF
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACTTTCTGCTGTCTTGGGTGCATTGGAGCCTTGCCTTGCTGCTCTACCTCCACCATGCCAAGTGGTCCCAGGCTGCACCCATGGCAGAAGGAGGAGGGCAGAATCATCACGAAGTGGTGAAGTTCATGGATGTCTATCAGCGCAGCTACTGCCATCCAATCGAGACCCTGGTGGACATCTTCCAGGAGTACCCTGATGAGATCGAGTACATCTTCAAGCCATCCTGTGTGCCCCTGATGCGATGCGGGGGCTGCTGCAATGACGAGGGCCTGGAGTGTGTGCCCACTGAGGAGTCCAACATCACCATGCAGATTATGCGGATCAAACCTCACCAAGGCCAGCACATAGGAGAGATGAGCTTCCTACAGCACAACAAATGTGAATGCAGACCAAAGAAAGATAGAGCAAGACAAGAAAATCCCTGTGGGCCTTGCTCAGAGCGGAGAAAGCATTTGTTTGTACAAGATCCGCAGACGTGTAAATGTTCCTGCAAAAACACAGACTCGCGTTGCAAGGCGAGGCAGCTTGAGTTAAACGAACGTACTTGCAGATGTGACAAGCCGAGGCGGTGA
ORF Protein Sequence MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-612 Pre-Made Vanucizumab biosimilar, Bispecific mAb, Anti-ANGPT2;VEGFA Antibody: Anti-AGPT2/ANG2/LMPHM10;VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-INN-757 Pre-Made Bevacizumab Beta Biosimilar, Whole Mab, Anti-Vegfa Antibody: Anti-MVCD1/VEGF/VPF therapeutic antibody
    Biosimilar GMP-Bios-INN-787 Pre-Made Conbercept Biosimilar, Fusion Protein targeting VEGFA fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting MVCD1/VEGF/VPF
    Biosimilar GMP-Bios-INN-813 Pre-Made Efdamrofusp Alfa P Alfaiosimilar, Bispecific, Anti-C3/CO3;C4B;VEGFA Antibody: Anti-AHUS5/ARMD9/ASP/CPAMD1/HEL-S-62p;CH/C4F/CO4/C4BD/C4B12/CPAMD3;VPF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-INN-722 Pre-Made Aflibercept Biosimilar, Fusion Protein targeting VEGFA fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting MVCD1/VEGF/VPF
    Biosimilar GMP-Bios-ab-369 Pre-Made Navicixizumab biosimilar, Bispecific mAb, Anti-DLL4;VEGFA Antibody: Anti-AOS6/delta4/hdelta2;VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-ab-145 Pre-Made Dilpacimab biosimilar, Bispecific mAb, Anti-DLL4;VEGFA Antibody: Anti-AOS6/delta4/hdelta2;VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-ab-065 Pre-Made Bevacizumab biosimilar, Whole mAb, Anti-VEGFA Antibody: Anti-VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-INN-1009 Pre-Made Tarcocimab Biosimilar, Whole Mab, Anti-Vegfa Antibody: Anti-MVCD1/VEGF/VPF therapeutic antibody
    Biosimilar GMP-Bios-ab-083 Pre-Made Brolucizumab biosimilar, scFv, Anti-VEGFA Antibody: Anti-VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-ab-470 Pre-Made Ranibizumab biosimilar, Fab, Anti-VEGFA Antibody: Anti-VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-ab-700 Pre-Made Tarcolimab biosimilar, Whole mAb, Anti-VEGFA Antibody: Anti-VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-ab-613 Pre-Made Varisacumab biosimilar, Whole mAb, Anti-VEGFA Antibody: Anti-VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-ab-204 Pre-Made Faricimab biosimilar, Bispecific mAb, Anti-VEGFA;ANGPT2 Antibody: Anti-VPF/VEGF/MVCD1;AGPT2/ANG2/LMPHM10 therapeutic antibody
    Biosimilar GMP-Bios-ab-674 Pre-Made Ivonescimab biosimilar, Whole mAb, Anti-VEGFA Antibody: Anti-VPF/VEGF/MVCD1 therapeutic antibody
    Target Antibody GM-Tg-g-T20761-Ab Anti-VEGFA/ MVCD1/ VEGF functional antibody
    Target Antigen GM-Tg-g-T20761-Ag VEGFA protein
    Cytokine cks-Tg-g-GM-T20761 Vascular endothelial growth factor A (VEGFA) protein & antibody
    ORF Viral Vector pGMLV001934 Human VEGFA Lentivirus plasmid
    ORF Viral Vector pGMAAV000016 Human VEGFA Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAAV000786 Human VEGFA Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMPC000083 Human VEGFA Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV001934 Human VEGFA Lentivirus particle
    ORF Viral Vector vGMAAV000016 Human VEGFA Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAAV000786 Human VEGFA Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T20761
    Target Name VEGFA
    Gene Group Identifier
    (Target Gene ID in Homo species)
    7422
    Gene ID 100033839 (Equus caballus), 22339 (Mus musculus), 281572 (Bos taurus), 403802 (Canis lupus familiaris)
    493845 (Felis catus), 574209 (Macaca mulatta), 7422 (Homo sapiens), 83785 (Rattus norvegicus)
    Gene Symbols & Synonyms VEGFA,Vegfa,VPF,Vpf,Vegf,L-VEGF,VEGF,VEGF-A,eVEGF120,eVEGF164,MVCD1,VEGF111,VEGF164
    Target Alternative Names L-VEGF,MVCD1,VEGF,VEGF-A,VEGF111,VEGF164,VEGFA,VPF,Vascular endothelial growth factor A,Vascular permeability factor (VPF),Vegf,Vegfa,Vpf,eVEGF120,eVEGF164,long form
    Uniprot Accession P15691,P15692,P16612,Q00731,Q9GKR0,Q9MYV3
    Additional SwissProt Accessions: Q9GKR0,Q00731,P15691,Q9MYV3,P15692,P16612
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Diagnostics Biomarker, Immuno-oncology Target, INN Index, Cytokine Target
    Disease cancer, Lung Cancer, Malignant neoplasm of prostate, Chronic Kidney Disease, Malignant neoplasm of bladder, Type 2 diabetes mellitus with diabetic nephropathy, Urinary bladder urothelial carcinoma
    Disease from KEGG EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, HIF-1 signaling pathway, PI3K-Akt signaling pathway, Focal adhesion, Relaxin signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Human cytomegalovirus infection, Human papillomavirus infection, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer, Proteoglycans in cancer, Chemical carcinogenesis - receptor activation, Renal cell carcinoma, Pancreatic cancer, Bladder cancer, Rheumatoid arthritis, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSECAG00000009402, ENSMUSG00000023951, ENSMMUG00000004577, ENSG00000112715
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.