Human BDNF/ANON2/BULN2 ORF/cDNA clone-Adeno-associate virus(AAV) particle (NM_170735.5)

Cat. No.: vGMAAV000575

Pre-made Human BDNF/ANON2/BULN2 Adeno-associated virus particle for BDNF in-vivo study, mechanism of action (MOA) research and BDNF-associated gene therapy development.

At GM Vector Core (GMVC), we stand at the forefront of custom AAV development and produce distinct grades of AAVs employing state-of-the-art methodologies. Uncover more about our expertise.

Target products collection

Go to BDNF/ANON2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name AAV serotype AAV Grade AAV quantity
vGMAAV000575 Human BDNF Adeno-associate virus(AAV) particle AAV1, AAV2, AAV2 variant (Y444F), AAV2 variant (Y272F, Y444F, Y500F, Y730F), AAV2 variant (Y444F, Y730F, Y500F, Y272F, Y704F, Y252F), AAV2 variant(AAV2.7m8), AAV5, AAV6, AAV8, AAV8-1m, AAV8-2m, AAV8 variant (Y733F, Y447F, Y275), AAV9, AAV-Rh.10, AAV-DJ, AAV-DJ/8, AAV-Retro (Retrograde), AAV9-PHP.B, AAV9-PHP.eB, AAV9-PHP.S, AAV-BR1, AAV-2i8, AAV-SIG, AAV-VEC, AAV4, AAV6.2, AAV6.2FF Pilot Grade 1.0E+12VG/ml
5.0E+12VG/ml
1E+13VG/ml
5E+13VG/ml
1E+14VG/ml
Research Grade 1.0E+12VG/ml
5.0E+12VG/ml
1E+13VG/ml
5E+13VG/ml
1E+14VG/ml
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAAV000575
Gene Name BDNF
Accession Number NM_170735.5
Gene ID 627
Species Human
Product Type Adeno-associate virus(AAV) particle (overexpression)
Insert Length 744 bp
Gene Alias ANON2,BULN2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCATCCTTTTCCTTACTATGGTTATTTCATACTTTGGTTGCATGAAGGCTGCCCCCATGAAAGAAGCAAACATCCGAGGACAAGGTGGCTTGGCCTACCCAGGTGTGCGGACCCATGGGACTCTGGAGAGCGTGAATGGGCCCAAGGCAGGTTCAAGAGGCTTGACATCATTGGCTGACACTTTCGAACACGTGATAGAAGAGCTGTTGGATGAGGACCAGAAAGTTCGGCCCAATGAAGAAAACAATAAGGACGCAGACTTGTACACGTCCAGGGTGATGCTCAGTAGTCAAGTGCCTTTGGAGCCTCCTCTTCTCTTTCTGCTGGAGGAATACAAAAATTACCTAGATGCTGCAAACATGTCCATGAGGGTCCGGCGCCACTCTGACCCTGCCCGCCGAGGGGAGCTGAGCGTGTGTGACAGTATTAGTGAGTGGGTAACGGCGGCAGACAAAAAGACTGCAGTGGACATGTCGGGCGGGACGGTCACAGTCCTTGAAAAGGTCCCTGTATCAAAAGGCCAACTGAAGCAATACTTCTACGAGACCAAGTGCAATCCCATGGGTTACACAAAAGAAGGCTGCAGGGGCATAGACAAAAGGCATTGGAACTCCCAGTGCCGAACTACCCAGTCGTACGTGCGGGCCCTTACCATGGATAGCAAAAAGAGAATTGGCTGGCGATTCATAAGGATAGACACTTCTTGTGTATGTACATTGACCATTAAAAGGGGAAGATAG
ORF Protein Sequence MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T93122-Ab Anti-BDNF/ ANON2/ BULN2 functional antibody
    Target Antigen GM-Tg-g-T93122-Ag BDNF protein
    ORF Viral Vector pGMLP004025 Human BDNF Lentivirus plasmid
    ORF Viral Vector pGMAD000577 Human BDNF Adenovirus plasmid
    ORF Viral Vector pGMAAV000575 Human BDNF Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAP000316 Human BDNF Adenovirus plasmid
    ORF Viral Vector pGMPC000136 Human BNDF Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC000188 Human BDNF Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC004727 Human BDNF Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP004025 Human BDNF Lentivirus particle
    ORF Viral Vector vGMAD000577 Human BDNF Adenovirus particle
    ORF Viral Vector vGMAAV000575 Human BDNF Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAP000316 Human BDNF Adenovirus particle


    Target information

    Target ID GM-T93122
    Target Name BDNF
    Gene Group Identifier
    (Target Gene ID in Homo species)
    627
    Gene ID 100009689 (Equus caballus), 12064 (Mus musculus), 24225 (Rattus norvegicus), 403461 (Canis lupus familiaris)
    493690 (Felis catus), 617701 (Bos taurus), 627 (Homo sapiens), 701245 (Macaca mulatta)
    Gene Symbols & Synonyms BDNF,Bdnf,ANON2,BULN2
    Target Alternative Names ANON2,Abrineurin,BDNF,BULN2,Bdnf,Brain-derived neurotrophic factor,Neurotrophic factor BDNF precursor form,proBDNF
    Uniprot Accession P21237,P23363,P23560,Q06225,Q0EAB7,Q7YRB4,Q95106,Q9TST3
    Additional SwissProt Accessions: Q0EAB7,P21237,P23363,Q7YRB4,Q9TST3,Q95106,P23560,Q06225
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer, Prostate Cancer, ovarian cancer, Overactive bladder, Autism, mental retardation, Allergic reactions, Asthma, Parkinson's Disease
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, cAMP signaling pathway, PI3K-Akt signaling pathway, Neurotrophin signaling pathway, Cocaine addiction
    Gene Ensembl ENSECAG00000015952, ENSMUSG00000048482, ENSBTAG00000008134, ENSG00000176697, ENSMMUG00000008634
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.