Human IL37/FIL1/FIL1(ZETA) ORF/cDNA clone-Adeno-associate virus(AAV) particle (NM_014439)
Cat. No.: vGMAAV000475
Pre-made Human IL37/FIL1/FIL1(ZETA) Adeno-associated virus particle for IL37 in-vivo study, mechanism of action (MOA) research and IL37-associated gene therapy development.
At GM Vector Core (GMVC), we stand at the forefront of custom AAV development and produce distinct grades of AAVs employing state-of-the-art methodologies. Uncover more about our expertise.
Go to
IL-1F7/IL-37/IL37/IL37/FIL1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | AAV serotype | AAV Grade | AAV quantity |
vGMAAV000475 | Human IL37 Adeno-associate virus(AAV) particle | AAV1, AAV2, AAV2 variant (Y444F), AAV2 variant (Y272F, Y444F, Y500F, Y730F), AAV2 variant (Y444F, Y730F, Y500F, Y272F, Y704F, Y252F), AAV2 variant(AAV2.7m8), AAV5, AAV6, AAV8, AAV8-1m, AAV8-2m, AAV8 variant (Y733F, Y447F, Y275), AAV9, AAV-Rh.10, AAV-DJ, AAV-DJ/8, AAV-Retro (Retrograde), AAV9-PHP.B, AAV9-PHP.eB, AAV9-PHP.S, AAV-BR1, AAV-2i8, AAV-SIG, AAV-VEC, AAV4, AAV6.2, AAV6.2FF | Pilot Grade | 1.0E+12VG/ml |
5.0E+12VG/ml | ||||
1E+13VG/ml | ||||
5E+13VG/ml | ||||
1E+14VG/ml | ||||
Research Grade | 1.0E+12VG/ml | |||
5.0E+12VG/ml | ||||
1E+13VG/ml | ||||
5E+13VG/ml | ||||
1E+14VG/ml | ||||
GMP-like Grade | inquiry | |||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAAV000475 |
Gene Name | IL37 |
Accession Number | NM_014439 |
Gene ID | 27178 |
Species | Human |
Product Type | Adeno-associate virus(AAV) particle (overexpression) |
Insert Length | 657 bp |
Gene Alias | FIL1,FIL1(ZETA),FIL1Z,IL-1F7,IL-1H,IL-1H4,IL-1RP1,IL-37,IL1F7,IL1H4,IL1RP1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTCCTTTGTGGGGGAGAACTCAGGAGTGAAAATGGGCTCTGAGGACTGGGAAAAAGATGAACCCCAGTGCTGCTTAGAAGACCCGGCTGGAAGCCCCCTGGAACCAGGCCCAAGCCTCCCCACCATGAATTTTGTTCACACAAGTCCAAAGGTGAAGAACTTAAACCCGAAGAAATTCAGCATTCATGACCAGGATCACAAAGTACTGGTCCTGGACTCTGGGAATCTCATAGCAGTTCCAGATAAAAACTACATACGCCCAGAGATCTTCTTTGCATTAGCCTCATCCTTGAGCTCAGCCTCTGCGGAGAAAGGAAGTCCGATTCTCCTGGGGGTCTCTAAAGGGGAGTTTTGTCTCTACTGTGACAAGGATAAAGGACAAAGTCATCCATCCCTTCAGCTGAAGAAGGAGAAACTGATGAAGCTGGCTGCCCAAAAGGAATCAGCACGCCGGCCCTTCATCTTTTATAGGGCTCAGGTGGGCTCCTGGAACATGCTGGAGTCGGCGGCTCACCCCGGATGGTTCATCTGCACCTCCTGCAATTGTAATGAGCCTGTTGGGGTGACAGATAAATTTGAGAACAGGAAACACATTGAATTTTCATTTCAACCAGTTTGCAAAGCTGAAATGAGCCCCAGTGAGGTCAGCGATTAG |
ORF Protein Sequence | MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T96845-Ab | Anti-IL37/ FIL1/ FIL1(ZETA) functional antibody |
Target Antigen | GM-Tg-g-T96845-Ag | IL37 protein |
Cytokine | cks-Tg-g-GM-T96845 | interleukin 37 (IL37) protein & antibody |
ORF Viral Vector | pGMLV000120 | Human IL37 Lentivirus plasmid |
ORF Viral Vector | pGMAAV000475 | Human IL37 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | pGMAP000269 | Human IL1F7 Adenovirus plasmid |
ORF Viral Vector | pGMLP-IL-043 | Human IL37 Lentivirus plasmid |
ORF Viral Vector | pGMAP-IL-126 | Human IL37 Adenovirus plasmid |
ORF Viral Vector | vGMLV000120 | Human IL37 Lentivirus particle |
ORF Viral Vector | vGMAAV000475 | Human IL37 Adeno-associate virus(AAV) particle |
ORF Viral Vector | vGMAP000269 | Human IL1F7 Adenovirus particle |
ORF Viral Vector | vGMLP-IL-043 | Human IL37 Lentivirus particle |
ORF Viral Vector | vGMAP-IL-126 | Human IL37 Adenovirus particle |
Target information
Target ID | GM-T96845 |
Target Name | IL-1F7/IL-37/IL37 |
Gene Group Identifier (Target Gene ID in Homo species) |
27178 |
Gene ID |
100052470 (Equus caballus), 100686057 (Canis lupus familiaris), 27178 (Homo sapiens), 700579 (Macaca mulatta) 786493 (Bos taurus) |
Gene Symbols & Synonyms | IL37,FIL1,FIL1Z,IL-1H,IL-23,IL-37,IL1F7,IL1H4,IL-1F7,IL-1H4,IL1RP1,IL-1RP1,FIL1(ZETA) |
Target Alternative Names | IL-1F7, IL-37, IL37,Interleukin-37,IL-37,FIL1 zeta, IL-1X, Interleukin-1 family member 7 (IL-1F7), Interleukin-1 homolog 4 (IL-1H, IL-1H4), Interleukin-1 zeta (IL-1 zeta), Interleukin-1-related protein (IL-1RP1),FIL1,FIL1Z,IL-1H,IL-23,IL-37,IL1F7,IL1H4,IL-1F7,IL-1H4,IL1RP1,IL-1RP1,FIL1(ZETA) |
Uniprot Accession |
Q9NZH6
Additional SwissProt Accessions: Q9NZH6 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, Cytokine Target |
Disease | |
Disease from KEGG | Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor |
Gene Ensembl | ENSECAG00000015732, ENSCAFG00845011516, ENSG00000125571, ENSMMUG00000005922, ENSBTAG00000013675 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.