Human TNFSF15/TL1/TL1A ORF/cDNA clone-Adeno-associate virus(AAV) particle (NM_005118)
Cat. No.: vGMAAV000281
Pre-made Human TNFSF15/TL1/TL1A Adeno-associated virus particle for TNFSF15 in-vivo study, mechanism of action (MOA) research and TNFSF15-associated gene therapy development.
At GM Vector Core (GMVC), we stand at the forefront of custom AAV development and produce distinct grades of AAVs employing state-of-the-art methodologies. Uncover more about our expertise.
Go to
TNFSF15/TL1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | AAV serotype | AAV Grade | AAV quantity |
| vGMAAV000281 | Human TNFSF15 Adeno-associate virus(AAV) particle | AAV1, AAV2, AAV2 variant (Y444F), AAV2 variant (Y272F, Y444F, Y500F, Y730F), AAV2 variant (Y444F, Y730F, Y500F, Y272F, Y704F, Y252F), AAV2 variant(AAV2.7m8), AAV5, AAV6, AAV8, AAV8-1m, AAV8-2m, AAV8 variant (Y733F, Y447F, Y275), AAV9, AAV-Rh.10, AAV-DJ, AAV-DJ/8, AAV-Retro (Retrograde), AAV9-PHP.B, AAV9-PHP.eB, AAV9-PHP.S, AAV-BR1, AAV-2i8, AAV-SIG, AAV-VEC, AAV4, AAV6.2, AAV6.2FF | Pilot Grade | 1.0E+12VG/ml |
| 5.0E+12VG/ml | ||||
| 1E+13VG/ml | ||||
| 5E+13VG/ml | ||||
| 1E+14VG/ml | ||||
| Research Grade | 1.0E+12VG/ml | |||
| 5.0E+12VG/ml | ||||
| 1E+13VG/ml | ||||
| 5E+13VG/ml | ||||
| 1E+14VG/ml | ||||
| GMP-like Grade | inquiry | |||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAAV000281 |
| Gene Name | TNFSF15 |
| Accession Number | NM_005118 |
| Gene ID | 9966 |
| Species | Human |
| Product Type | Adeno-associate virus(AAV) particle (overexpression) |
| Insert Length | 756 bp |
| Gene Alias | TL1,TL1A,TNLG1B,VEGI,VEGI192A |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | Null |
| Promoter | TBG |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCGAGGATCTGGGACTGAGCTTTGGGGAAACAGCCAGTGTGGAAATGCTGCCAGAGCACGGCAGCTGCAGGCCCAAGGCCAGGAGCAGCAGCGCACGCTGGGCTCTCACCTGCTGCCTGGTGTTGCTCCCCTTCCTTGCAGGACTCACCACATACCTGCTTGTCAGCCAGCTCCGGGCCCAGGGAGAGGCCTGTGTGCAGTTCCAGGCTCTAAAAGGACAGGAGTTTGCACCTTCACATCAGCAAGTTTATGCACCTCTTAGAGCAGACGGAGATAAGCCAAGGGCACACCTGACAGTTGTGAGACAAACTCCCACACAGCACTTTAAAAATCAGTTCCCAGCTCTGCACTGGGAACATGAACTAGGCCTGGCCTTCACCAAGAACCGAATGAACTATACCAACAAATTCCTGCTGATCCCAGAGTCGGGAGACTACTTCATTTACTCCCAGGTCACATTCCGTGGGATGACCTCTGAGTGCAGTGAAATCAGACAAGCAGGCCGACCAAACAAGCCAGACTCCATCACTGTGGTCATCACCAAGGTAACAGACAGCTACCCTGAGCCAACCCAGCTCCTCATGGGGACCAAGTCTGTATGCGAAGTAGGTAGCAACTGGTTCCAGCCCATCTACCTCGGAGCCATGTTCTCCTTGCAAGAAGGGGACAAGCTAATGGTGAACGTCAGTGACATCTCTTTGGTGGATTACACAAAAGAAGATAAAACCTTCTTTGGAGCCTTCTTACTATAG |
| ORF Protein Sequence | MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T35212-Ab | Anti-TNF15/ TNFSF15/ TL1 monoclonal antibody |
| Target Antigen | GM-Tg-g-T35212-Ag | TNFSF15 VLP (virus-like particle) |
| Cytokine | cks-Tg-g-GM-T35212 | Tumor necrosis factor superfamily member 15 (TNFSF15) protein & antibody |
| ORF Viral Vector | pGMLP004530 | Human TNFSF15 Lentivirus plasmid |
| ORF Viral Vector | pGMAAV000281 | Human TNFSF15 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | vGMLP004530 | Human TNFSF15 Lentivirus particle |
| ORF Viral Vector | vGMAAV000281 | Human TNFSF15 Adeno-associate virus(AAV) particle |
Target information
| Target ID | GM-T35212 |
| Target Name | TNFSF15 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
9966 |
| Gene ID |
100049906 (Equus caballus), 101099505 (Felis catus), 252878 (Rattus norvegicus), 326623 (Mus musculus) 481688 (Canis lupus familiaris), 514239 (Bos taurus), 703189 (Macaca mulatta), 9966 (Homo sapiens) |
| Gene Symbols & Synonyms | TNFSF15,Tnfsf15,TNLG1B,Tnlg1b,Tl1,Tl1a,Vegi,TL1,TL1A,VEGI,VEGI192A |
| Target Alternative Names | TL1,TL1A,TNF ligand-related molecule 1,TNFSF15,TNLG1B,Tl1,Tl1a,Tnfsf15,Tnlg1b,Tumor necrosis factor ligand superfamily member 15,VEGI,VEGI192A,Vascular endothelial cell growth inhibitor,Vegi |
| Uniprot Accession |
O95150,Q5UBV8,Q8K3Y7
Additional SwissProt Accessions: Q8K3Y7,Q5UBV8,O95150 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Cytokine Target |
| Disease | cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction |
| Gene Ensembl | ENSECAG00000014513, ENSMUSG00000050395, ENSBTAG00000018069, ENSMMUG00000012892, ENSG00000181634 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


