Human FGF19 ORF/cDNA clone-Adeno-associate virus(AAV) particle (NM_005117.2)

Cat. No.: vGMAAV000215

Pre-made Human FGF19/ Adeno-associated virus particle for FGF19 in-vivo study, mechanism of action (MOA) research and FGF19-associated gene therapy development.

At GM Vector Core (GMVC), we stand at the forefront of custom AAV development and produce distinct grades of AAVs employing state-of-the-art methodologies. Uncover more about our expertise.

Target products collection

Go to FGF19 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name AAV serotype AAV Grade AAV quantity
vGMAAV000215 Human FGF19 Adeno-associate virus(AAV) particle AAV1, AAV2, AAV2 variant (Y444F), AAV2 variant (Y272F, Y444F, Y500F, Y730F), AAV2 variant (Y444F, Y730F, Y500F, Y272F, Y704F, Y252F), AAV2 variant(AAV2.7m8), AAV5, AAV6, AAV8, AAV8-1m, AAV8-2m, AAV8 variant (Y733F, Y447F, Y275), AAV9, AAV-Rh.10, AAV-DJ, AAV-DJ/8, AAV-Retro (Retrograde), AAV9-PHP.B, AAV9-PHP.eB, AAV9-PHP.S, AAV-BR1, AAV-2i8, AAV-SIG, AAV-VEC, AAV4, AAV6.2, AAV6.2FF Pilot Grade 1.0E+12VG/ml
5.0E+12VG/ml
1E+13VG/ml
5E+13VG/ml
1E+14VG/ml
Research Grade 1.0E+12VG/ml
5.0E+12VG/ml
1E+13VG/ml
5E+13VG/ml
1E+14VG/ml
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAAV000215
Gene Name FGF19
Accession Number NM_005117.2
Gene ID 9965
Species Human
Product Type Adeno-associate virus(AAV) particle (overexpression)
Insert Length 651 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGGAGCGGGTGTGTGGTGGTCCACGTATGGATCCTGGCCGGCCTCTGGCTGGCCGTGGCCGGGCGCCCCCTCGCCTTCTCGGACGCGGGGCCCCACGTGCACTACGGCTGGGGCGACCCCATCCGCCTGCGGCACCTGTACACCTCCGGCCCCCACGGGCTCTCCAGCTGCTTCCTGCGCATCCGTGCCGACGGCGTCGTGGACTGCGCGCGGGGCCAGAGCGCGCACAGTTTGCTGGAGATCAAGGCAGTCGCTCTGCGGACCGTGGCCATCAAGGGCGTGCACAGCGTGCGGTACCTCTGCATGGGCGCCGACGGCAAGATGCAGGGGCTGCTTCAGTACTCGGAGGAAGACTGTGCTTTCGAGGAGGAGATCCGCCCAGATGGCTACAATGTGTACCGATCCGAGAAGCACCGCCTCCCGGTCTCCCTGAGCAGTGCCAAACAGCGGCAGCTGTACAAGAACAGAGGCTTTCTTCCACTCTCTCATTTCCTGCCCATGCTGCCCATGGTCCCAGAGGAGCCTGAGGACCTCAGGGGCCACTTGGAATCTGACATGTTCTCTTCGCCCCTGGAGACCGACAGCATGGACCCATTTGGGCTTGTCACCGGACTGGAGGCCGTGAGGAGTCCCAGCTTTGAGAAGTAA
ORF Protein Sequence MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0215-Ab Anti-FGF19 functional antibody
    Target Antigen GM-Tg-g-SE0215-Ag FGF19 protein
    Cytokine cks-Tg-g-GM-SE0215 fibroblast growth factor 19 (FGF19) protein & antibody
    ORF Viral Vector pGMLP004563 Human FGF19 Lentivirus plasmid
    ORF Viral Vector pGMAAV000215 Human FGF19 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLP004563 Human FGF19 Lentivirus particle
    ORF Viral Vector vGMAAV000215 Human FGF19 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-SE0215
    Target Name FGF19
    Gene Group Identifier
    (Target Gene ID in Homo species)
    9965
    Gene ID 100060488 (Equus caballus), 101087099 (Felis catus), 14170 (Mus musculus), 170582 (Rattus norvegicus)
    483681 (Canis lupus familiaris), 521475 (Bos taurus), 709109 (Macaca mulatta), 9965 (Homo sapiens)
    Gene Symbols & Synonyms FGF19,Fgf15,Fgf19,Fgf8a,FGF8A
    Target Alternative Names FGF-19,FGF19,FGF8A,Fgf15,Fgf19,Fgf8a,Fibroblast growth factor 19
    Uniprot Accession O35622,O95750
    Additional SwissProt Accessions: O35622,O95750
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease cancer
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Regulation of actin cytoskeleton, Pathways in cancer, Melanoma, Breast cancer, Gastric cancer
    Gene Ensembl ENSECAG00000036646, ENSMUSG00000031073, ENSCAFG00845015136, ENSBTAG00000017285, ENSMMUG00000053386, ENSG00000162344
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.