Mouse Hamp/Hamp1/Hepc ORF/cDNA clone-Adeno-associate virus(AAV) particle (NM_032541)
Cat. No.: vGMAAV000089
Pre-made Mouse Hamp/Hamp1/Hepc Adeno-associated virus particle for Hamp in-vivo study, mechanism of action (MOA) research and Hamp-associated gene therapy development.
At GM Vector Core (GMVC), we stand at the forefront of custom AAV development and produce distinct grades of AAVs employing state-of-the-art methodologies. Uncover more about our expertise.
Product information
| Catalog No. | Product Name | AAV serotype | AAV Grade | AAV quantity |
| vGMAAV000089 | Mouse Hamp Adeno-associate virus(AAV) particle | AAV1, AAV2, AAV2 variant (Y444F), AAV2 variant (Y272F, Y444F, Y500F, Y730F), AAV2 variant (Y444F, Y730F, Y500F, Y272F, Y704F, Y252F), AAV2 variant(AAV2.7m8), AAV5, AAV6, AAV8, AAV8-1m, AAV8-2m, AAV8 variant (Y733F, Y447F, Y275), AAV9, AAV-Rh.10, AAV-DJ, AAV-DJ/8, AAV-Retro (Retrograde), AAV9-PHP.B, AAV9-PHP.eB, AAV9-PHP.S, AAV-BR1, AAV-2i8, AAV-SIG, AAV-VEC, AAV4, AAV6.2, AAV6.2FF | Pilot Grade | 1.0E+12VG/ml |
| 5.0E+12VG/ml | ||||
| 1E+13VG/ml | ||||
| 5E+13VG/ml | ||||
| 1E+14VG/ml | ||||
| Research Grade | 1.0E+12VG/ml | |||
| 5.0E+12VG/ml | ||||
| 1E+13VG/ml | ||||
| 5E+13VG/ml | ||||
| 1E+14VG/ml | ||||
| GMP-like Grade | inquiry | |||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAAV000089 |
| Gene Name | Hamp |
| Accession Number | NM_032541 |
| Gene ID | 84506 |
| Species | Mouse |
| Product Type | Adeno-associate virus(AAV) particle (overexpression) |
| Insert Length | 252 bp |
| Gene Alias | Hamp1,Hepc,Hepc1 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCACTCAGCACTCGGACCCAGGCTGCCTGTCTCCTGCTTCTCCTCCTTGCCAGCCTGAGCAGCACCACCTATCTCCATCAACAGATGAGACAGACTACAGAGCTGCAGCCTTTGCACGGGGAAGAAAGCAGGGCAGACATTGCGATACCAATGCAGAAGAGAAGGAAGAGAGACACCAACTTCCCCATCTGCATCTTCTGCTGTAAATGCTGTAACAATTCCCAGTGTGGTATCTGTTGCAAAACATAG |
| ORF Protein Sequence | MALSTRTQAACLLLLLLASLSSTTYLHQQMRQTTELQPLHGEESRADIAIPMQKRRKRDTNFPICIFCCKCCNNSQCGICCKT |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| ORF Viral Vector | pGMAAV000089 | Mouse Hamp Adeno-associate virus(AAV) plasmid |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.

