Human NPPB/BNP ORF/cDNA clone-Adeno-associate virus(AAV) particle (NM_002521.2)
Cat. No.: vGMAAV000027
Pre-made Human NPPB/BNP Adeno-associated virus particle for NPPB in-vivo study, mechanism of action (MOA) research and NPPB-associated gene therapy development.
At GM Vector Core (GMVC), we stand at the forefront of custom AAV development and produce distinct grades of AAVs employing state-of-the-art methodologies. Uncover more about our expertise.
Go to
BNP/NPPB/NPPB/BNP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | AAV serotype | AAV Grade | AAV quantity |
| vGMAAV000027 | Human NPPB Adeno-associate virus(AAV) particle | AAV1, AAV2, AAV2 variant (Y444F), AAV2 variant (Y272F, Y444F, Y500F, Y730F), AAV2 variant (Y444F, Y730F, Y500F, Y272F, Y704F, Y252F), AAV2 variant(AAV2.7m8), AAV5, AAV6, AAV8, AAV8-1m, AAV8-2m, AAV8 variant (Y733F, Y447F, Y275), AAV9, AAV-Rh.10, AAV-DJ, AAV-DJ/8, AAV-Retro (Retrograde), AAV9-PHP.B, AAV9-PHP.eB, AAV9-PHP.S, AAV-BR1, AAV-2i8, AAV-SIG, AAV-VEC, AAV4, AAV6.2, AAV6.2FF | Pilot Grade | 1.0E+12VG/ml |
| 5.0E+12VG/ml | ||||
| 1E+13VG/ml | ||||
| 5E+13VG/ml | ||||
| 1E+14VG/ml | ||||
| Research Grade | 1.0E+12VG/ml | |||
| 5.0E+12VG/ml | ||||
| 1E+13VG/ml | ||||
| 5E+13VG/ml | ||||
| 1E+14VG/ml | ||||
| GMP-like Grade | inquiry | |||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAAV000027 |
| Gene Name | NPPB |
| Accession Number | NM_002521.2 |
| Gene ID | 4879 |
| Species | Human |
| Product Type | Adeno-associate virus(AAV) particle (overexpression) |
| Insert Length | 405 bp |
| Gene Alias | BNP |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | Null |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGATCCCCAGACAGCACCTTCCCGGGCGCTCCTGCTCCTGCTCTTCTTGCATCTGGCTTTCCTGGGAGGTCGTTCCCACCCGCTGGGCAGCCCCGGTTCAGCCTCGGACTTGGAAACGTCCGGGTTACAGGAGCAGCGCAACCATTTGCAGGGCAAACTGTCGGAGCTGCAGGTGGAGCAGACATCCCTGGAGCCCCTCCAGGAGAGCCCCCGTCCCACAGGTGTCTGGAAGTCCCGGGAGGTAGCCACCGAGGGCATCCGTGGGCACCGCAAAATGGTCCTCTACACCCTGCGGGCACCACGAAGCCCCAAGATGGTGCAAGGGTCTGGCTGCTTTGGGAGGAAGATGGACCGGATCAGCTCCTCCAGTGGCCTGGGCTGCAAAGTGCTGAGGCGGCATTAA |
| ORF Protein Sequence | MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T55302-Ab | Anti-ANFB/ BNP/ NPPB functional antibody |
| Target Antigen | GM-Tg-g-T55302-Ag | BNP/NPPB protein |
| ORF Viral Vector | pGMAAV000027 | Human NPPB Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | vGMAAV000027 | Human NPPB Adeno-associate virus(AAV) particle |
Target information
| Target ID | GM-T55302 |
| Target Name | BNP/NPPB |
|
Gene Group Identifier (Target Gene ID in Homo species) |
4879 |
| Gene ID |
100056123 (Equus caballus), 18158 (Mus musculus), 25105 (Rattus norvegicus), 487441 (Canis lupus familiaris) 4879 (Homo sapiens), 493764 (Felis catus), 508734 (Bos taurus), 715053 (Macaca mulatta) |
| Gene Symbols & Synonyms | NPPB,Nppb,BNF,BNP,Iso-ANP,Bnf,NNX |
| Target Alternative Names | BNF,BNP,Bnf,Brain natriuretic factor prohormone (preproBNP,Gamma-brain natriuretic peptide,Iso-ANP,NNX,NPPB,Natriuretic peptides B,Nppb,proBNP) |
| Uniprot Accession |
P13204,P13205,P16859,P16860,P40753
Additional SwissProt Accessions: P40753,P13205,P16859,P16860,P13204 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Diagnostics Biomarker |
| Disease | |
| Disease from KEGG | cGMP-PKG signaling pathway, Vascular smooth muscle contraction |
| Gene Ensembl | ENSECAG00000014282, ENSMUSG00000029019, ENSCAFG00845001994, ENSG00000120937, ENSBTAG00000021739, ENSMMUG00000055655 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


