Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human VEGFA/MVCD1/VEGF ORF/cDNA clone-Adeno-associate virus(AAV) particle (NM_001171626.1)
Cat. No.: vGMAAV000016
Pre-made Human VEGFA/MVCD1/VEGF Adeno-associated virus particle for VEGFA in-vivo study, mechanism of action (MOA) research and VEGFA-associated gene therapy development.
At GM Vector Core (GMVC), we stand at the forefront of custom AAV development and produce distinct grades of AAVs employing state-of-the-art methodologies. Uncover more about our expertise.
Go to
VEGFA/MVCD1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
MSDS
Product information
| Catalog No. | Product Name | AAV serotype | AAV Grade | AAV quantity |
| vGMAAV000016 | Human VEGFA Adeno-associate virus(AAV) particle | AAV1, AAV2, AAV2 variant (Y444F), AAV2 variant (Y272F, Y444F, Y500F, Y730F), AAV2 variant (Y444F, Y730F, Y500F, Y272F, Y704F, Y252F), AAV2 variant(AAV2.7m8), AAV5, AAV6, AAV8, AAV8-1m, AAV8-2m, AAV8 variant (Y733F, Y447F, Y275), AAV9, AAV-Rh.10, AAV-DJ, AAV-DJ/8, AAV-Retro (Retrograde), AAV9-PHP.B, AAV9-PHP.eB, AAV9-PHP.S, AAV-BR1, AAV-2i8, AAV-SIG, AAV-VEC, AAV4, AAV6.2, AAV6.2FF | Pilot Grade | 1.0E+12VG/ml |
| 5.0E+12VG/ml | ||||
| 1E+13VG/ml | ||||
| 5E+13VG/ml | ||||
| 1E+14VG/ml | ||||
| Research Grade | 1.0E+12VG/ml | |||
| 5.0E+12VG/ml | ||||
| 1E+13VG/ml | ||||
| 5E+13VG/ml | ||||
| 1E+14VG/ml | ||||
| GMP-like Grade | inquiry | |||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAAV000016 |
| Gene Name | VEGFA |
| Accession Number | NM_001171626.1 |
| Gene ID | 7422 |
| Species | Human |
| Product Type | Adeno-associate virus(AAV) particle (overexpression) |
| Insert Length | 576 bp |
| Gene Alias | MVCD1,VEGF,VPF |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAACTTTCTGCTGTCTTGGGTGCATTGGAGCCTTGCCTTGCTGCTCTACCTCCACCATGCCAAGTGGTCCCAGGCTGCACCCATGGCAGAAGGAGGAGGGCAGAATCATCACGAAGTGGTGAAGTTCATGGATGTCTATCAGCGCAGCTACTGCCATCCAATCGAGACCCTGGTGGACATCTTCCAGGAGTACCCTGATGAGATCGAGTACATCTTCAAGCCATCCTGTGTGCCCCTGATGCGATGCGGGGGCTGCTGCAATGACGAGGGCCTGGAGTGTGTGCCCACTGAGGAGTCCAACATCACCATGCAGATTATGCGGATCAAACCTCACCAAGGCCAGCACATAGGAGAGATGAGCTTCCTACAGCACAACAAATGTGAATGCAGACCAAAGAAAGATAGAGCAAGACAAGAAAATCCCTGTGGGCCTTGCTCAGAGCGGAGAAAGCATTTGTTTGTACAAGATCCGCAGACGTGTAAATGTTCCTGCAAAAACACAGACTCGCGTTGCAAGGCGAGGCAGCTTGAGTTAAACGAACGTACTTGCAGATGTGACAAGCCGAGGCGGTGA |
| ORF Protein Sequence | MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Target information
| Target ID | GM-T20761 |
| Target Name | VEGFA |
|
Gene Group Identifier （Target Gene ID in Homo species) |
7422 |
| Gene ID |
100033839 (Equus caballus), 22339 (Mus musculus), 281572 (Bos taurus), 403802 (Canis lupus familiaris) 493845 (Felis catus), 574209 (Macaca mulatta), 7422 (Homo sapiens), 83785 (Rattus norvegicus) |
| Gene Symbols & Synonyms | VEGFA,Vegfa,VPF,Vpf,Vegf,L-VEGF,VEGF,VEGF-A,eVEGF120,eVEGF164,MVCD1,VEGF111,VEGF164 |
| Target Alternative Names | L-VEGF,MVCD1,VEGF,VEGF-A,VEGF111,VEGF164,VEGFA,VPF,Vascular endothelial growth factor A,Vascular permeability factor (VPF),Vegf,Vegfa,Vpf,eVEGF120,eVEGF164,long form |
| Uniprot Accession |
P15691,P15692,P16612,Q00731,Q9GKR0,Q9MYV3
Additional SwissProt Accessions: Q9GKR0,Q00731,P15691,Q9MYV3,P15692,P16612 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Diagnostics Biomarker, Immuno-oncology Target, INN Index, Cytokine Target |
| Disease | cancer, Lung Cancer, Malignant neoplasm of prostate, Chronic Kidney Disease, Malignant neoplasm of bladder, Type 2 diabetes mellitus with diabetic nephropathy, Urinary bladder urothelial carcinoma |
| Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, HIF-1 signaling pathway, PI3K-Akt signaling pathway, Focal adhesion, Relaxin signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Human cytomegalovirus infection, Human papillomavirus infection, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer, Proteoglycans in cancer, Chemical carcinogenesis - receptor activation, Renal cell carcinoma, Pancreatic cancer, Bladder cancer, Rheumatoid arthritis, Fluid shear stress and atherosclerosis |
| Gene Ensembl | ENSECAG00000009402, ENSMUSG00000023951, ENSMMUG00000004577, ENSG00000112715 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.