Human CD59/16.3A5/1F5 ORF/cDNA clone-Adeno-associate virus(AAV) particle (NM_000611.5)
Cat. No.: vGMAAV000004
Pre-made Human CD59/16.3A5/1F5 Adeno-associated virus particle for CD59 in-vivo study, mechanism of action (MOA) research and CD59-associated gene therapy development.
At GM Vector Core (GMVC), we stand at the forefront of custom AAV development and produce distinct grades of AAVs employing state-of-the-art methodologies. Uncover more about our expertise.
Go to
CD59/16.3A5 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | AAV serotype | AAV Grade | AAV quantity |
| vGMAAV000004 | Human CD59 Adeno-associate virus(AAV) particle | AAV1, AAV2, AAV2 variant (Y444F), AAV2 variant (Y272F, Y444F, Y500F, Y730F), AAV2 variant (Y444F, Y730F, Y500F, Y272F, Y704F, Y252F), AAV2 variant(AAV2.7m8), AAV5, AAV6, AAV8, AAV8-1m, AAV8-2m, AAV8 variant (Y733F, Y447F, Y275), AAV9, AAV-Rh.10, AAV-DJ, AAV-DJ/8, AAV-Retro (Retrograde), AAV9-PHP.B, AAV9-PHP.eB, AAV9-PHP.S, AAV-BR1, AAV-2i8, AAV-SIG, AAV-VEC, AAV4, AAV6.2, AAV6.2FF | Pilot Grade | 1.0E+12VG/ml |
| 5.0E+12VG/ml | ||||
| 1E+13VG/ml | ||||
| 5E+13VG/ml | ||||
| 1E+14VG/ml | ||||
| Research Grade | 1.0E+12VG/ml | |||
| 5.0E+12VG/ml | ||||
| 1E+13VG/ml | ||||
| 5E+13VG/ml | ||||
| 1E+14VG/ml | ||||
| GMP-like Grade | inquiry | |||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAAV000004 |
| Gene Name | CD59 |
| Accession Number | NM_000611.5 |
| Gene ID | 966 |
| Species | Human |
| Product Type | Adeno-associate virus(AAV) particle (overexpression) |
| Insert Length | 387 bp |
| Gene Alias | 16.3A5,1F5,EJ16,EJ30,EL32,G344,HRF-20,HRF20,MAC-IP,MACIF,MEM43,MIC11,MIN1,MIN2,MIN3,MIRL,MSK21,p18-20 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGGAATCCAAGGAGGGTCTGTCCTGTTCGGGCTGCTGCTCGTCCTGGCTGTCTTCTGCCATTCAGGTCATAGCCTGCAGTGCTACAACTGTCCTAACCCAACTGCTGACTGCAAAACAGCCGTCAATTGTTCATCTGATTTTGATGCGTGTCTCATTACCAAAGCTGGGTTACAAGTGTATAACAAGTGTTGGAAGTTTGAGCATTGCAATTTCAACGACGTCACAACCCGCTTGAGGGAAAATGAGCTAACGTACTACTGCTGCAAGAAGGACCTGTGTAACTTTAACGAACAGCTTGAAAATGGTGGGACATCCTTATCAGAGAAAACAGTTCTTCTGCTGGTGACTCCATTTCTGGCAGCAGCCTGGAGCCTTCATCCCTAA |
| ORF Protein Sequence | MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T78552-Ab | Anti-CD59/ 16.3A5/ 1F5 monoclonal antibody |
| Target Antigen | GM-Tg-g-T78552-Ag | CD59 VLP (virus-like particle) |
| ORF Viral Vector | pGMAAV000004 | Human CD59 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | vGMAAV000004 | Human CD59 Adeno-associate virus(AAV) particle |
Target information
| Target ID | GM-T78552 |
| Target Name | CD59 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
966 |
| Gene ID |
101092210 (Felis catus), 106781397 (Equus caballus), 25407 (Rattus norvegicus), 475945 (Canis lupus familiaris) 505574 (Bos taurus), 693402 (Macaca mulatta), 966 (Homo sapiens) |
| Gene Symbols & Synonyms | CD59,Cd59b,Cd59,Cd59a,MACIF,MACIP,MAC-IP,1F5,EJ16,EJ30,EL32,G344,MIN1,MIN2,MIN3,MIRL,HRF20,MEM43,MIC11,MSK21,16.3A5,HRF-20,p18-20 |
| Target Alternative Names | 16.3A5,1F5,1F5 antigen,20 kDa homologous restriction factor (HRF-20,CD59,CD59 glycoprotein,Cd59,Cd59a,Cd59b,EJ16,EJ30,EL32,G344,HRF-20,HRF20,HRF20),MAC-IP,MAC-inhibitory protein (MAC-IP),MACIF,MACIP,MEM43,MEM43 antigen,MIC11,MIN1,MIN2,MIN3,MIRL,MSK21,Membrane attack complex inhibition factor (MACIF),Membrane inhibitor of reactive lysis (MIRL),Protectin,p18-20 |
| Uniprot Accession |
P13987,P27274
Additional SwissProt Accessions: P27274,P13987 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | cancer, Ovary Cancer, Contact with and (suspected) exposure to environmental tobacco smoke (acute) (chronic), Contrast - Induced Nephropathy, Dent disease, IgA glomerulonephritis, Ovarian cancer, Type 1 diabetes mellitus |
| Disease from KEGG | Complement and coagulation cascades, Hematopoietic cell lineage |
| Gene Ensembl | ENSECAG00000027924, ENSCAFG00845025193, ENSBTAG00000002302, ENSMMUG00000055602, ENSG00000085063 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


