Human ZDHHC21/DHHC-21/DHHC21 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001354118.2)

Cat. No.: pGMPC004879
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ZDHHC21/DHHC-21/DHHC21 Non-Viral expression plasmid (overexpression vector) for mouse ZDHHC21 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to ZDHHC21/DHHC-21 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC004879
Gene Name ZDHHC21
Accession Number NM_001354118.2
Gene ID 340481
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 798 bp
Gene Alias DHHC-21,DHHC21,DNZ1,HSPC097
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xHA (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGTCTCCGGATTCACTTTGTTGTTGACCCACATGGTTGGTGCTGCATGGGTTTGATTGTCTTTGTTTGGTTATACAATATTGTTTTAATTCCCAAAATTGTCCTCTTTCCTCACTATGAAGAAGGACATATTCCAGGCATATTAATAATAATATTCTATGGCATTTCCATATTCTGTCTGGTTGCCTTAGTGAGGGCCTCCATAACTGATCCAGGAAGACTCCCTGAGAACCCCAAGATCCCACATGGAGAAAGGGAGTTCTGGGAATTATGTAACAAGTGTAATTTGATGAGACCAAAGCGTTCCCATCACTGTAGCCGCTGCGGCCACTGTGTGAGGAGAATGGATCATCACTGTCCATGGATTAACAATTGTGTTGGTGAAGATAATCATTGGCTCTTTCTGCAGTTGTGTTTCTACACTGAACTTCTTACTTGCTACGCACTGATGTTTTCTTTCTGCCACTATTACTATTTTCTTCCACTAAAAAAGCGTAATTTGGACCTCTTTGTTTTTAGACATGAATTGGCCATAATGAGACTAGCAGCCTTTATGGGCATTACTATGTTAGTTGGAATAACTGGACTCTTTTACACTCAACTAATTGGCATCATCACAGATACAACATCTATTGAAAAGATGTCAAACTGTTGTGAAGATATATCGAGGCCCCGAAAGCCATGGCAGCAGACCTTCTCAGAAGTTTTTGGCACTCGTTGGAAGATCCTGTGGTTCATTCCTTTCAGGCAGAGGCAACCACTGCGAGTTCCCTACCACTTTGCCAATCATGTCTAA
ORF Protein Sequence MGLRIHFVVDPHGWCCMGLIVFVWLYNIVLIPKIVLFPHYEEGHIPGILIIIFYGISIFCLVALVRASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCEDISRPRKPWQQTFSEVFGTRWKILWFIPFRQRQPLRVPYHFANHV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1959-Ab Anti-ZDH21/ ZDHHC21/ DHHC-21 monoclonal antibody
    Target Antigen GM-Tg-g-MP1959-Ag ZDHHC21 VLP (virus-like particle)
    ORF Viral Vector pGMPC004879 Human ZDHHC21 Mammalian (Non-Viral Vector) plasmid


    Target information

    Target ID GM-MP1959
    Target Name ZDHHC21
    Gene Group Identifier
    (Target Gene ID in Homo species)
    340481
    Gene ID 100062221 (Equus caballus), 101095925 (Felis catus), 298184 (Rattus norvegicus), 340481 (Homo sapiens)
    481546 (Canis lupus familiaris), 535814 (Bos taurus), 68268 (Mus musculus), 715247 (Macaca mulatta)
    Gene Symbols & Synonyms ZDHHC21,Zdhhc21,DNZ1,DHHC21,DHHC-21,HSPC097,dep,9130404H11Rik,D130004H04Rik
    Target Alternative Names ZDHHC21,Palmitoyltransferase ZDHHC21,DHHC domain-containing cysteine-rich protein 21 (DHHC-21), Zinc finger DHHC domain-containing protein 21,DNZ1,DHHC21,DHHC-21,HSPC097
    Uniprot Accession A2VDT6,Q8IVQ6,Q9D270
    Additional SwissProt Accessions: Q8IVQ6,A2VDT6,Q9D270
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000014502, ENSG00000175893, ENSCAFG00845011296, ENSBTAG00000006197, ENSMUSG00000028403, ENSMMUG00000012426
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.