Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human IL21/CVID11/IL-21 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_021803.4)
Cat. No.: pGMPC004772
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL21/CVID11/IL-21 Non-Viral expression plasmid (overexpression vector) for mouse IL21 overexpression in unique cell transient transfection and stable cell line development.
Datasheet
Go to
IL-21/IL21/IL21/CVID11 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC004772 |
| Gene Name | IL21 |
| Accession Number | NM_021803.4 |
| Gene ID | 59067 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 489 bp |
| Gene Alias | CVID11,IL-21,Za11 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | Null |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGATCCAGTCCTGGCAACATGGAGAGGATTGTCATCTGTCTGATGGTCATCTTCTTGGGGACACTGGTCCACAAATCAAGCTCCCAAGGTCAAGATCGCCACATGATTAGAATGCGTCAACTTATAGATATTGTTGATCAGCTGAAAAATTATGTGAATGACTTGGTCCCTGAATTTCTGCCAGCTCCAGAAGATGTAGAGACAAACTGTGAGTGGTCAGCTTTTTCCTGCTTTCAGAAGGCCCAACTAAAGTCAGCAAATACAGGAAACAATGAAAGGATAATCAATGTATCAATTAAAAAGCTGAAGAGGAAACCACCTTCCACAAATGCAGGGAGAAGACAGAAACACAGACTAACATGCCCTTCATGTGATTCTTATGAGAAAAAACCACCCAAAGAATTCCTAGAAAGATTCAAATCACTTCTCCAAAAGATGATTCATCAGCATCTGTCCTCTAGAACACACGGAAGTGAAGATTCCTGA |
| ORF Protein Sequence | MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-ab-041 | Pre-Made Avizakimab biosimilar, Whole mAb, Anti-IL21 Antibody: Anti-CVID11/IL-21/Za11 therapeutic antibody |
| Target Antibody | GM-Tg-g-T51223-Ab | Anti-IL21/ CVID11/ IL-21 functional antibody |
| Target Antigen | GM-Tg-g-T51223-Ag | IL21 protein |
| ORF Viral Vector | pGMLP002995 | Human IL21 Lentivirus plasmid |
| ORF Viral Vector | pGMLP-IL-028 | Human IL21 Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-111 | Human IL21 Adenovirus plasmid |
| ORF Viral Vector | pGMPC001659 | Human IL21 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC004772 | Human IL21 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP002995 | Human IL21 Lentivirus particle |
| ORF Viral Vector | vGMLP-IL-028 | Human IL21 Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-111 | Human IL21 Adenovirus particle |
Target information
| Target ID | GM-T51223 |
| Target Name | IL-21/IL21 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
59067 |
| Gene ID |
100063803 (Equus caballus), 101087399 (Felis catus), 365769 (Rattus norvegicus), 378475 (Bos taurus) 442935 (Canis lupus familiaris), 59067 (Homo sapiens), 60505 (Mus musculus), 708125 (Macaca mulatta) |
| Gene Symbols & Synonyms | IL21,Il21,IL-21,Za11,CVID11 |
| Target Alternative Names | CVID11,IL-21,IL21,Il21,Interleukin-21,Za11 |
| Uniprot Accession |
A3QPB9,Q6L7I9,Q76LU5,Q9ES17,Q9HBE4
Additional SwissProt Accessions: A3QPB9,Q76LU5,Q6L7I9,Q9HBE4,Q9ES17 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, INN Index |
| Disease | cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway, Th17 cell differentiation, Inflammatory bowel disease |
| Gene Ensembl | ENSECAG00000037491, ENSBTAG00000012368, ENSCAFG00845020106, ENSG00000138684, ENSMUSG00000027718, ENSMMUG00000049383 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.