Human CSF2/CSF/GMCSF ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_000758.4)
Cat. No.: pGMPC004740
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CSF2/CSF/GMCSF Non-Viral expression plasmid (overexpression vector) for mouse CSF2 overexpression in unique cell transient transfection and stable cell line development.
Go to
GM-CSF/CSF2/CSF2/CSF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC004740 |
| Gene Name | CSF2 |
| Accession Number | NM_000758.4 |
| Gene ID | 1437 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 435 bp |
| Gene Alias | CSF,GMCSF |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | Null |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTGGCTGCAGAGCCTGCTGCTCTTGGGCACTGTGGCCTGCAGCATCTCTGCACCCGCCCGCTCGCCCAGCCCCAGCACGCAGCCCTGGGAGCATGTGAATGCCATCCAGGAGGCCCGGCGTCTCCTGAACCTGAGTAGAGACACTGCTGCTGAGATGAATGAAACAGTAGAAGTCATCTCAGAAATGTTTGACCTCCAGGAGCCGACCTGCCTACAGACCCGCCTGGAGCTGTACAAGCAGGGCCTGCGGGGCAGCCTCACCAAGCTCAAGGGCCCCTTGACCATGATGGCCAGCCACTACAAGCAGCACTGCCCTCCAACCCCGGAAACTTCCTGTGCAACCCAGATTATCACCTTTGAAAGTTTCAAAGAGAACCTGAAGGACTTTCTGCTTGTCATCCCCTTTGACTGCTGGGAGCCAGTCCAGGAGTGA |
| ORF Protein Sequence | MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Target information
| Target ID | GM-T74002 |
| Target Name | GM-CSF/CSF2 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
1437 |
| Gene ID |
100033981 (Equus caballus), 101094153 (Felis catus), 116630 (Rattus norvegicus), 12981 (Mus musculus) 1437 (Homo sapiens), 281095 (Bos taurus), 403923 (Canis lupus familiaris), 574371 (Macaca mulatta) |
| Gene Symbols & Synonyms | CSF2,Csf2,GM-CSF,Gmcsf,Gm-csf,CSF,Csfgm,GMCSF,Gm-CSf,MGI-IGM |
| Target Alternative Names | CSF,CSF2,Colony-stimulating factor (CSF),Csf2,Csfgm,GM-CSF,GMCSF,Gm-CSf,Gm-csf,Gmcsf,Granulocyte-macrophage colony-stimulating factor,MGI-IGM,Molgramostin,Sargramostim |
| Uniprot Accession |
P01587,P04141,P11052,P48749,P48750
Additional SwissProt Accessions: P48750,P01587,P04141,P11052,P48749 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Immuno-oncology Target, INN Index |
| Disease | metastatic tumors, Overactive bladder |
| Disease from KEGG | Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway, Hematopoietic cell lineage, Natural killer cell mediated cytotoxicity, IL-17 signaling pathway, T cell receptor signaling pathway, Fc epsilon RI signaling pathway, TNF signaling pathway, Amoebiasis, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Acute myeloid leukemia, Rheumatoid arthritis |
| Gene Ensembl | ENSECAG00000009678, ENSMUSG00000018916, ENSG00000164400, ENSBTAG00000001570, ENSCAFG00845009774, ENSMMUG00000016915 |
| Target Classification | Pathway, Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


