Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human IFITM1/9-27/CD225 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_003641.5)
Cat. No.: pGMPC001656
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IFITM1/9-27/CD225 Non-Viral expression plasmid (overexpression vector) for mouse IFITM1 overexpression in unique cell transient transfection and stable cell line development.
Datasheet
Go to
IFITM1/CD225/IFITM1/9-27 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC001656 |
| Gene Name | IFITM1 |
| Accession Number | NM_003641.5 |
| Gene ID | 8519 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 378 bp |
| Gene Alias | 9-27,CD225,DSPA2a,IFI17,LEU13 |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Null |
| Fusion Tag | Null |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCACAAGGAGGAACATGAGGTGGCTGTGCTGGGGCCACCCCCCAGCACCATCCTTCCAAGGTCCACCGTGATCAACATCCACAGCGAGACCTCCGTGCCCGACCATGTCGTCTGGTCCCTGTTCAACACCCTCTTCTTGAACTGGTGCTGTCTGGGCTTCATAGCATTCGCCTACTCCGTGAAGTCTAGGGACAGGAAGATGGTTGGCGACGTGACCGGGGCCCAGGCCTATGCCTCCACCGCCAAGTGCCTGAACATCTGGGCCCTGATTCTGGGCATCCTCATGACCATTGGATTCATCCTGTTACTGGTATTCGGCTCTGTGACAGTCTACCATATTATGTTACAGATAATACAGGAAAAACGGGGTTACTAG |
| ORF Protein Sequence | MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP0603-Ab | Anti-IFM1/ IFITM1/CD225 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP0603-Ag | IFITM1 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000062 | Human IFITM1 Lentivirus plasmid |
| ORF Viral Vector | pGMPC001656 | Human IFITM1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000062 | Human IFITM1 Lentivirus particle |
Target information
| Target ID | GM-MP0603 |
| Target Name | IFITM1/CD225 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
8519 |
| Gene ID | 8519 (Homo sapiens) |
| Gene Symbols & Synonyms | IFITM1,9-27,CD225,IFI17,LEU13,DSPA2a |
| Target Alternative Names | 9-27,CD225,DSPA2a,Dispanin subfamily A member 2a (DSPA2a),IFI17,IFITM1,Interferon-induced protein 17,Interferon-induced transmembrane protein 1,Interferon-inducible protein 9-27,LEU13,Leu-13 antigen |
| Uniprot Accession |
P13164
Additional SwissProt Accessions: P13164 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | |
| Disease | cancer |
| Disease from KEGG | B cell receptor signaling pathway |
| Gene Ensembl | ENSG00000185885 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.