Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human GDF15/GDF-15/MIC-1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_004864.4)
Cat. No.: pGMPC001615
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human GDF15/GDF-15/MIC-1 Non-Viral expression plasmid (overexpression vector) for mouse GDF15 overexpression in unique cell transient transfection and stable cell line development.
Datasheet
Go to
GDF15/GDF-15 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC001615 |
| Gene Name | GDF15 |
| Accession Number | NM_004864.4 |
| Gene ID | 9518 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 927 bp |
| Gene Alias | GDF-15,MIC-1,MIC1,NAG-1,PDF,PLAB,PTGFB |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Null |
| Fusion Tag | 6xHis (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCCCGGGCAAGAACTCAGGACGGTGAATGGCTCTCAGATGCTCCTGGTGTTGCTGGTGCTCTCGTGGCTGCCGCATGGGGGCGCCCTGTCTCTGGCCGAGGCGAGCCGCGCAAGTTTCCCGGGACCCTCAGAGTTGCACTCCGAAGACTCCAGATTCCGAGAGTTGCGGAAACGCTACGAGGACCTGCTAACCAGGCTGCGGGCCAACCAGAGCTGGGAAGATTCGAACACCGACCTCGTCCCGGCCCCTGCAGTCCGGATACTCACGCCAGAAGTGCGGCTGGGATCCGGCGGCCACCTGCACCTGCGTATCTCTCGGGCCGCCCTTCCCGAGGGGCTCCCCGAGGCCTCCCGCCTTCACCGGGCTCTGTTCCGGCTGTCCCCGACGGCGTCAAGGTCGTGGGACGTGACACGACCGCTGCGGCGTCAGCTCAGCCTTGCAAGACCCCAGGCGCCCGCGCTGCACCTGCGACTGTCGCCGCCGCCGTCGCAGTCGGACCAACTGCTGGCAGAATCTTCGTCCGCACGGCCCCAGCTGGAGTTGCACTTGCGGCCGCAAGCCGCCAGGGGGCGCCGCAGAGCGCGTGCGCGCAACGGGGACCACTGTCCGCTCGGGCCCGGGCGTTGCTGCCGTCTGCACACGGTCCGCGCGTCGCTGGAAGACCTGGGCTGGGCCGATTGGGTGCTGTCGCCACGGGAGGTGCAAGTGACCATGTGCATCGGCGCGTGCCCGAGCCAGTTCCGGGCGGCAAACATGCACGCGCAGATCAAGACGAGCCTGCACCGCCTGAAGCCCGACACGGTGCCAGCGCCCTGCTGCGTGCCCGCCAGCTACAATCCCATGGTGCTCATTCAAAAGACCGACACCGGGGTGTCGCTCCAGACCTATGATGACTTGTTAGCCAAAGACTGCCACTGCATATGA |
| ORF Protein Sequence | MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-ab-451 | Pre-Made Ponsegromab biosimilar, Whole mAb, Anti-GDF15 Antibody: Anti-GDF-15/MIC-1/MIC1/NAG-1/PDF/PLAB/PTGFB therapeutic antibody |
| Target Antibody | GM-Tg-g-T33245-Ab | Anti-GDF15/ GDF-15/ MIC-1 functional antibody |
| Target Antigen | GM-Tg-g-T33245-Ag | GDF15 protein |
| Cytokine | cks-Tg-g-GM-T33245 | growth differentiation factor 15 (GDF15) protein & antibody |
| ORF Viral Vector | pGMLP000446 | Human GDF15 Lentivirus plasmid |
| ORF Viral Vector | pGMPC001615 | Human GDF15 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000446 | Human GDF15 Lentivirus particle |
Target information
| Target ID | GM-T33245 |
| Target Name | GDF15 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
9518 |
| Gene ID |
101086633 (Felis catus), 111769675 (Equus caballus), 23886 (Mus musculus), 29455 (Rattus norvegicus) 484822 (Canis lupus familiaris), 618677 (Bos taurus), 719466 (Macaca mulatta), 9518 (Homo sapiens) |
| Gene Symbols & Synonyms | GDF15,Gdf15,SBF,MIC-1,NAG-1,HG,PDF,MIC1,PLAB,PTGFB,GDF-15 |
| Target Alternative Names | GDF-15,GDF15,Gdf15,Growth/differentiation factor 15,HG,MIC-1,MIC1,Macrophage inhibitory cytokine 1 (MIC-1),NAG-1,NSAID-activated gene 1 protein (NAG-1),NSAID-regulated gene 1 protein (NRG-1),PDF,PLAB,PTGFB,Placental TGF-beta,Placental bone morphogenetic protein,Prostate differentiation factor,SBF |
| Uniprot Accession |
Q99988,Q9Z0J6,Q9Z0J7
Additional SwissProt Accessions: Q9Z0J7,Q9Z0J6,Q99988 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Diagnostics Biomarker, INN Index, Cytokine Target |
| Disease | cancer, Ovary Cancer |
| Disease from KEGG | Cytokine-cytokine receptor interaction |
| Gene Ensembl | ENSECAG00000039579, ENSMUSG00000038508, ENSCAFG00845022411, ENSBTAG00000015618, ENSMMUG00000050122, ENSG00000130513 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.