Human VAMP2/NEDHAHM/SYB2 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_014232)
Cat. No.: pGMPC001583
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human VAMP2/NEDHAHM/SYB2 Non-Viral expression plasmid (overexpression vector) for mouse VAMP2 overexpression in unique cell transient transfection and stable cell line development.
Go to
VAMP2/NEDHAHM products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC001583 |
| Gene Name | VAMP2 |
| Accession Number | NM_014232 |
| Gene ID | 6844 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 351 bp |
| Gene Alias | NEDHAHM,SYB2,VAMP-2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCTGCTACCGCTGCCACGGCCCCCCCTGCTGCCCCGGCTGGGGAGGGTGGTCCCCCTGCACCCCCTCCAAACCTCACCAGTAACAGGAGACTGCAGCAGACCCAGGCCCAGGTGGATGAGGTGGTGGACATCATGAGGGTGAACGTGGACAAGGTCCTGGAGCGAGACCAGAAGCTGTCGGAGCTGGACGACCGTGCAGATGCACTCCAGGCGGGGGCCTCCCAGTTTGAAACAAGCGCAGCCAAGCTCAAGCGCAAATACTGGTGGAAAAACCTCAAGATGATGATCATCTTGGGAGTGATTTGCGCCATCATCCTCATCATCATCATAGTTTACTTCAGCACTTAA |
| ORF Protein Sequence | MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-TA101-Ab | Anti-VAMP2/ SYB2/ VAMP-2 monoclonal antibody |
| Target Antigen | GM-Tg-g-TA101-Ag | VAMP2 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000806 | Human VAMP2 Lentivirus plasmid |
| ORF Viral Vector | pGMPC001583 | Human VAMP2 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000806 | Human VAMP2 Lentivirus particle |
Target information
| Target ID | GM-TA101 |
| Target Name | VAMP2 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
6844 |
| Gene ID |
100073047 (Equus caballus), 101101516 (Felis catus), 22318 (Mus musculus), 24803 (Rattus norvegicus) 282116 (Bos taurus), 479491 (Canis lupus familiaris), 574134 (Macaca mulatta), 6844 (Homo sapiens) |
| Gene Symbols & Synonyms | VAMP2,Vamp2,Syb2,Syb-2,sybII,Vamp-2,SYB,RATVAMPB,RATVAMPIR,SYB2,VAMP-2,NEDHAHM |
| Target Alternative Names | NEDHAHM,RATVAMPB,RATVAMPIR,SYB,SYB2,Syb-2,Syb2,Synaptobrevin-2,VAMP-2,VAMP2,Vamp-2,Vamp2,Vesicle-associated membrane protein 2,sybII |
| Uniprot Accession |
P63026,P63027,P63044,P63045,Q9N0Y0
Additional SwissProt Accessions: P63044,P63045,P63026,Q9N0Y0,P63027 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | |
| Disease from KEGG | SNARE interactions in vesicular transport, Insulin secretion, Salivary secretion |
| Gene Ensembl | ENSECAG00000014189, ENSMUSG00000020894, ENSBTAG00000054934, ENSCAFG00845028001, ENSMMUG00000021798, ENSG00000220205 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


