Human TMSB4X/FX/PTMB4 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_021109)

Cat. No.: pGMPC001441
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TMSB4X/FX/PTMB4 Non-Viral expression plasmid (overexpression vector) for mouse TMSB4X overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to Thymosin beta 4/TMSB4X/TMSB4X/FX products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001441
Gene Name TMSB4X
Accession Number NM_021109
Gene ID 7114
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 135 bp
Gene Alias FX,PTMB4,TB4X,TMSB4
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 6xHis (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGACAAACCCGATATGGCTGAGATCGAGAAATTCGATAAGTCGAAACTGAAGAAGACAGAGACGCAAGAGAAAAATCCACTGCCTTCCAAAGAAACGATTGAACAGGAGAAGCAAGCAGGCGAATCGTAA
ORF Protein Sequence MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T85005-Ab Anti-TMSB4X monoclonal antibody
    Target Antigen GM-Tg-g-T85005-Ag TMSB4X protein
    ORF Viral Vector pGMLP003137 Human TMSB4X Lentivirus plasmid
    ORF Viral Vector pGMLV000075 Human TMSB4X Lentivirus plasmid
    ORF Viral Vector pGMLV001370 Human TMSB4X Lentivirus plasmid
    ORF Viral Vector pGMLV002575 Human TMSB4X Lentivirus plasmid
    ORF Viral Vector pGMPC001441 Human TMSB4X Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003137 Human TMSB4X Lentivirus particle
    ORF Viral Vector vGMLV000075 Human TMSB4X Lentivirus particle
    ORF Viral Vector vGMLV001370 Human TMSB4X Lentivirus particle
    ORF Viral Vector vGMLV002575 Human TMSB4X Lentivirus particle


    Target information

    Target ID GM-T85005
    Target Name Thymosin beta 4/TMSB4X
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7114
    Gene ID 100034015 (Equus caballus), 100684977 (Canis lupus familiaris), 101088815 (Felis catus), 19241 (Mus musculus)
    282386 (Bos taurus), 710959 (Macaca mulatta), 7114 (Homo sapiens), 81814 (Rattus norvegicus)
    Gene Symbols & Synonyms TMSB4X,Tmsb4x,THYB4,TMSB4,Tb4,Ptmb4,Tbeta4,FX,TB4X,PTMB4
    Target Alternative Names FX,Fx,PTMB4,Ptmb4,T beta-4,TB4X,THYB4,TMSB4,TMSB4X,Tb4,Tbeta4,Thymosin beta 4,Thymosin beta-4,Tmsb4x
    Uniprot Accession P20065,P62327,P62328,P62329
    Additional SwissProt Accessions: P62327,P20065,P62328,P62329
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG Regulation of actin cytoskeleton
    Gene Ensembl ENSCAFG00845028351, ENSMUSG00000049775, ENSBTAG00000038488, ENSG00000205542
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.