Human ATF4/CREB-2/CREB2 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001675)
Cat. No.: pGMPC001314
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human ATF4/CREB-2/CREB2 Non-Viral expression plasmid (overexpression vector) for mouse ATF4 overexpression in unique cell transient transfection and stable cell line development.
Go to
ATF4/ATF-4/ATF4/CREB-2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMPC001314 |
Gene Name | ATF4 |
Accession Number | NM_001675 |
Gene ID | 468 |
Species | Human |
Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
Insert Length | 1056 bp |
Gene Alias | CREB-2,CREB2,TAXREB67,TXREB |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACCGAAATGAGCTTCCTGAGCAGCGAGGTGTTGGTGGGGGACTTGATGTCCCCCTTCGACCAGTCGGGTTTGGGGGCTGAAGAAAGCCTAGGTCTCTTAGATGATTACCTGGAGGTGGCCAAGCACTTCAAACCTCATGGGTTCTCCAGCGACAAGGCTAAGGCGGGCTCCTCCGAATGGCTGGCTGTGGATGGGTTGGTCAGTCCCTCCAACAACAGCAAGGAGGATGCCTTCTCCGGGACAGATTGGATGTTGGAGAAAATGGATTTGAAGGAGTTCGACTTGGATGCCCTGTTGGGTATAGATGACCTGGAAACCATGCCAGATGACCTTCTGACCACGTTGGATGACACTTGTGATCTCTTTGCCCCCCTAGTCCAGGAGACTAATAAGCAGCCCCCCCAGACGGTGAACCCAATTGGCCATCTCCCAGAAAGTTTAACAAAACCCGACCAGGTTGCCCCCTTCACCTTCTTACAACCTCTTCCCCTTTCCCCAGGGGTCCTGTCCTCCACTCCAGATCATTCCTTTAGTTTAGAGCTGGGCAGTGAAGTGGATATCACTGAAGGAGATAGGAAGCCAGACTACACTGCTTACGTTGCCATGATCCCTCAGTGCATAAAGGAGGAAGACACCCCTTCAGATAATGATAGTGGCATCTGTATGAGCCCAGAGTCCTATCTGGGGTCTCCTCAGCACAGCCCCTCTACCAGGGGCTCTCCAAATAGGAGCCTCCCATCTCCAGGTGTTCTCTGTGGGTCTGCCCGTCCCAAACCTTACGATCCTCCTGGAGAGAAGATGGTAGCAGCAAAAGTAAAGGGTGAGAAACTGGATAAGAAGCTGAAAAAAATGGAGCAAAACAAGACAGCAGCCACTAGGTACCGCCAGAAGAAGAGGGCGGAGCAGGAGGCTCTTACTGGTGAGTGCAAAGAGCTGGAAAAGAAGAACGAGGCTCTAAAAGAGAGGGCGGATTCCCTGGCCAAGGAGATCCAGTACCTGAAAGATTTGATAGAAGAGGTCCGCAAGGCAAGGGGGAAGAAAAGGGTCCCCTAG |
ORF Protein Sequence | MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T53270-Ab | Anti-ATF-4 monoclonal antibody |
Target Antigen | GM-Tg-g-T53270-Ag | ATF-4/ATF4 protein |
ORF Viral Vector | pGMLV000321 | Human ATF4 Lentivirus plasmid |
ORF Viral Vector | pGMLV000496 | Human ATF4 Lentivirus plasmid |
ORF Viral Vector | pGMPC000693 | Human ATF4 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC001314 | Human ATF4 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLV000321 | Human ATF4 Lentivirus particle |
ORF Viral Vector | vGMLV000496 | Human ATF4 Lentivirus particle |
Target information
Target ID | GM-T53270 |
Target Name | ATF4/ATF-4 |
Gene Group Identifier (Target Gene ID in Homo species) |
468 |
Gene ID |
100070334 (Equus caballus), 101084297 (Felis catus), 11911 (Mus musculus), 468 (Homo sapiens) 474503 (Canis lupus familiaris), 509107 (Bos taurus), 703965 (Macaca mulatta), 79255 (Rattus norvegicus) |
Gene Symbols & Synonyms | ATF4,Atf4,Atf-4,C/ATF,CREB2,CREB-2,TAXREB67,TXREB |
Target Alternative Names | ATF4, ATF-4,Cyclic AMP-dependent transcription factor ATF-4,cAMP-dependent transcription factor ATF-4,Activating transcription factor 4, Cyclic AMP-responsive element-binding protein 2 (CREB-2, cAMP-responsive element-binding protein 2), Tax-responsive enhancer element-binding protein 67 (TaxREB67),CREB2,TXREB,CREB-2,TAXREB67 |
Uniprot Accession |
P18848,Q06507,Q3ZCH6,Q9ES19
Additional SwissProt Accessions: Q06507,P18848,Q3ZCH6,Q9ES19 |
Uniprot Entry Name | |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | cancer |
Disease from KEGG | MAPK signaling pathway, cGMP-PKG signaling pathway, Protein processing in endoplasmic reticulum, PI3K-Akt signaling pathway, Apoptosis, Longevity regulating pathway, Adrenergic signaling in cardiomyocytes, TNF signaling pathway, Long-term potentiation, Neurotrophin signaling pathway, Cholinergic synapse, Insulin secretion, GnRH signaling pathway, Thyroid hormone synthesis, Aldosterone synthesis and secretion, Relaxin signaling pathway, Cortisol synthesis and secretion, Parathyroid hormone synthesis, secretion and action, Cushing syndrome, Growth hormone synthesis, secretion and action, Alzheimer disease, Cocaine addiction, Amphetamine addiction, Hepatitis B, Human cytomegalovirus infection, Human T-cell leukemia virus 1 infection, Chemical carcinogenesis - receptor activation, Prostate cancer, Lipid and atherosclerosis |
Gene Ensembl | ENSMUSG00000042406, ENSG00000128272, ENSCAFG00845021497, ENSBTAG00000017462, ENSMMUG00000055780 |
Target Classification | Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.