Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human CXCL9/CMK/crg-10 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002416)
Cat. No.: pGMPC001262
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CXCL9/CMK/crg-10 Non-Viral expression plasmid (overexpression vector) for mouse CXCL9 overexpression in unique cell transient transfection and stable cell line development.
Datasheet
Go to
CXCL9/MIG/CXCL9/CMK products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC001262 |
| Gene Name | CXCL9 |
| Accession Number | NM_002416 |
| Gene ID | 4283 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 378 bp |
| Gene Alias | CMK,crg-10,Humig,MIG,SCYB9 |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | Null |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAAGAAAAGTGGTGTTCTTTTCCTCTTGGGCATCATCTTGCTGGTTCTGATTGGAGTGCAAGGAACCCCAGTAGTGAGAAAGGGTCGCTGTTCCTGCATCAGCACCAACCAAGGGACTATCCACCTACAATCCTTGAAAGACCTTAAACAATTTGCCCCAAGCCCTTCCTGCGAGAAAATTGAAATCATTGCTACACTGAAGAATGGAGTTCAAACATGTCTAAACCCAGATTCAGCAGATGTGAAGGAACTGATTAAAAAGTGGGAGAAACAGGTCAGCCAAAAGAAAAAGCAAAAGAATGGGAAAAAACATCAAAAAAAGAAAGTTCTGAAAGTTCGAAAATCTCAACGTTCTCGTCAAAAGAAGACTACATAA |
| ORF Protein Sequence | MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T56349-Ab | Anti-CXCL9/ CMK/ Humig functional antibody |
| Target Antigen | GM-Tg-g-T56349-Ag | CXCL9 protein |
| Cytokine | cks-Tg-g-GM-T56349 | chemokine (C-X-C motif) ligand 9 (CXCL9) protein & antibody |
| ORF Viral Vector | pGMLP002749 | Human CXCL9 Lentivirus plasmid |
| ORF Viral Vector | pGMPC001262 | Human CXCL9 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP002749 | Human CXCL9 Lentivirus particle |
Target information
| Target ID | GM-T56349 |
| Target Name | CXCL9/MIG |
|
Gene Group Identifier （Target Gene ID in Homo species) |
4283 |
| Gene ID |
100057927 (Equus caballus), 101100388 (Felis catus), 17329 (Mus musculus), 246759 (Rattus norvegicus) 4283 (Homo sapiens), 513990 (Bos taurus), 574336 (Macaca mulatta) |
| Gene Symbols & Synonyms | CXCL9,Cxcl9,CMK,Mig,MuMIG,Scyb9,crg-10,MIG,Humig,SCYB9 |
| Target Alternative Names | C-X-C motif chemokine 9,CMK,CXCL9,Cxcl9,Gamma-interferon-induced monokine,Humig,MIG,MIG),Mig,Monokine induced by interferon-gamma (HuMIG,MuMIG,SCYB9,Scyb9,Small-inducible cytokine B9,crg-10 |
| Uniprot Accession |
A9QWP9,P18340,Q07325
Additional SwissProt Accessions: P18340,Q07325,A9QWP9 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Immuno-oncology Target, Cytokine Target |
| Disease | cancer, Hyperacute Allograft Rejection, Complications of kidney transplant, Kidney transplant rejection |
| Disease from KEGG | Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, Toll-like receptor signaling pathway |
| Gene Ensembl | ENSECAG00000046132, ENSMUSG00000029417, ENSG00000138755, ENSBTAG00000069240 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.