Human S100A9/60B8AG/CAGB ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002965.4)

Cat. No.: pGMPC001206
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human S100A9/60B8AG/CAGB Non-Viral expression plasmid (overexpression vector) for mouse S100A9 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to S100A9/60B8AG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001206
Gene Name S100A9
Accession Number NM_002965.4
Gene ID 6280
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 345 bp
Gene Alias 60B8AG,CAGB,CFAG,CGLB,L1AG,LIAG,MAC387,MIF,MRP14,NIF,P14,S100-A9
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 6xHis (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTTGCAAAATGTCGCAGCTGGAACGCAACATAGAGACCATCATCAACACCTTCCACCAATACTCTGTGAAGCTGGGGCACCCAGACACCCTGAACCAGGGGGAATTCAAAGAGCTGGTGCGAAAAGATCTGCAAAATTTTCTCAAGAAGGAGAATAAGAATGAAAAGGTCATAGAACACATCATGGAGGACCTGGACACAAATGCAGACAAGCAGCTGAGCTTCGAGGAGTTCATCATGCTGATGGCGAGGCTAACCTGGGCCTCCCACGAGAAGATGCACGAGGGTGACGAGGGCCCTGGCCACCACCATAAGCCAGGCCTCGGGGAGGGCACCCCCTAA
ORF Protein Sequence MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T38431-Ab Anti-S10A9/ S100A9/ 60B8AG monoclonal antibody
    Target Antigen GM-Tg-g-T38431-Ag S100A9 VLP (virus-like particle)
    ORF Viral Vector pGMLP003387 Human S100A9 Lentivirus plasmid
    ORF Viral Vector pGMPC000118 Human S100a9 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC000398 Human S100A9 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001206 Human S100A9 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003387 Human S100A9 Lentivirus particle


    Target information

    Target ID GM-T38431
    Target Name S100A9
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6280
    Gene ID 100061730 (Equus caballus), 101084419 (Felis catus), 20202 (Mus musculus), 490463 (Canis lupus familiaris)
    532569 (Bos taurus), 6280 (Homo sapiens), 714690 (Macaca mulatta), 94195 (Rattus norvegicus)
    Gene Symbols & Synonyms S100A9,S100a9,p14,Cagb,GAGB,L1Ag,BEE22,MRP14,60B8Ag,MIF,NIF,P14,CAGB,CFAG,CGLB,L1AG,LIAG,60B8AG,MAC387,S100-A9,Mrp14
    Target Alternative Names 60B8AG,60B8Ag,BEE22,CAGB,CFAG,CGLB,Cagb,Calgranulin-B,Calprotectin L1H subunit,GAGB,L1AG,L1Ag,LIAG,Leukocyte L1 complex heavy chain,MAC387,MIF,MRP14,Migration inhibitory factor-related protein 14 (MRP-14,Mrp14,NIF,P14,Protein S100-A9,S100 calcium-binding protein A9,S100-A9,S100A9,S100a9,p14,p14)
    Uniprot Accession P06702,P28783,P31725,P50116
    Additional SwissProt Accessions: P31725,P28783,P06702,P50116
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Diagnostics Biomarker
    Disease cancer, Glucose intolerance, Congenital occlusion of ureteropelvic junction, Gastrointestinal system cancer, Diabetic Nephropathy, Liver cell carcinoma, Perinatal necrotizing enterocolitis
    Disease from KEGG IL-17 signaling pathway
    Gene Ensembl ENSECAG00000010117, ENSMUSG00000056071, ENSCAFG00845002276, ENSBTAG00000006505, ENSG00000163220, ENSMMUG00000006868
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.