Human MAPK12/ERK-6/ERK3 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002969)

Cat. No.: pGMPC001119
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MAPK12/ERK-6/ERK3 Non-Viral expression plasmid (overexpression vector) for mouse MAPK12 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to MAPK12/ERK-6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001119
Gene Name MAPK12
Accession Number NM_002969
Gene ID 6300
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 1104 bp
Gene Alias ERK-6,ERK3,ERK6,MAPK 12,P38GAMMA,PRKM12,SAPK-3,SAPK3
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCTCTCCGCCGCCCGCCCGCAGTGGCTTTTACCGCCAGGAGGTGACCAAGACGGCCTGGGAGGTGCGCGCCGTGTACCGGGACCTGCAGCCCGTGGGCTCGGGCGCCTACGGCGCGGTGTGCTCGGCCGTGGACGGCCGCACCGGCGCTAAGGTGGCCATCAAGAAGCTGTATCGGCCTTTCCAGTCCGAGCTGTTCGCCAAGCGCGCCTACCGCGAGCTGCGCCTGCTCAAGCACATGCGCCACGAGAACGTGATCGGGCTGCTGGACGTATTCACTCCTGATGAGACCCTGGATGACTTCACGGACTTTTACCTGGTGATGCCGTTCATGGGCACCGACCTGGGCAAGCTCATGAAACATGAGAAGCTAGGCGAGGACCGGATCCAGTTCCTCGTGTACCAGATGCTGAAGGGGCTGAGGTATATCCACGCTGCCGGCATCATCCACAGAGACCTGAAGCCCGGCAACCTGGCTGTGAACGAAGACTGTGAGCTGAAGATCCTGGACTTCGGCCTGGCCAGGCAGGCAGACAGTGAGATGACTGGGTACGTGGTGACCCGGTGGTACCGGGCTCCCGAGGTCATCTTGAATTGGATGCGCTACACGCAGACGGTGGACATCTGGTCTGTGGGCTGCATCATGGCGGAGATGATCACAGGCAAGACGCTGTTCAAGGGCAGCGACCACCTGGACCAGCTGAAGGAGATCATGAAGGTGACGGGGACGCCTCCGGCTGAGTTTGTGCAGCGGCTGCAGAGCGATGAGGCCAAGAACTACATGAAGGGCCTCCCCGAATTGGAGAAGAAGGATTTTGCCTCTATCCTGACCAATGCAAGCCCTCTGGCTGTGAACCTCCTGGAGAAGATGCTGGTGCTGGACGCGGAGCAGCGGGTGACGGCAGGCGAGGCGCTGGCCCATCCCTACTTCGAGTCCCTGCACGACACGGAAGATGAGCCCCAGGTCCAGAAGTATGATGACTCCTTTGACGACGTTGACCGCACACTGGATGAATGGAAGCGTGTTACTTACAAAGAGGTGCTCAGCTTCAAGCCTCCCCGGCAGCTGGGGGCCAGGGTCTCCAAGGAGACGCCTCTGTGA
ORF Protein Sequence MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T79798-Ab Anti-MAPK12 monoclonal antibody
    Target Antigen GM-Tg-g-T79798-Ag MAPK12 protein
    ORF Viral Vector pGMLP005401 Human MAPK12 Lentivirus plasmid
    ORF Viral Vector pGMPC001119 Human MAPK12 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP005401 Human MAPK12 Lentivirus particle


    Target information

    Target ID GM-T79798
    Target Name MAPK12
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6300
    Gene ID 100056239 (Equus caballus), 111556320 (Felis catus), 29857 (Mus musculus), 512943 (Bos taurus)
    60352 (Rattus norvegicus), 607023 (Canis lupus familiaris), 6300 (Homo sapiens), 715745 (Macaca mulatta)
    Gene Symbols & Synonyms MAPK12,Mapk12,Erk6,Sapk3,Prkm12,P38gamma,ERK3,ERK6,ERK-6,SAPK3,PRKM12,SAPK-3,MAPK 12,P38GAMMA
    Target Alternative Names ERK-6,ERK3,ERK6,Erk6,Extracellular signal-regulated kinase 6 (ERK-6),MAP kinase 12,MAPK 12,MAPK12,Mapk12,Mitogen-activated protein kinase 12,Mitogen-activated protein kinase p38 gamma (MAP kinase p38 gamma),P38GAMMA,P38gamma,PRKM12,Prkm12,SAPK-3,SAPK3,Sapk3,Stress-activated protein kinase 3
    Uniprot Accession O08911,P53778,Q63538
    Additional SwissProt Accessions: O08911,Q63538,P53778
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG Endocrine resistance, MAPK signaling pathway, Rap1 signaling pathway, FoxO signaling pathway, Sphingolipid signaling pathway, Cellular senescence, Adrenergic signaling in cardiomyocytes, Osteoclast differentiation, Signaling pathways regulating pluripotency of stem cells, Platelet activation, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, C-type lectin receptor signaling pathway, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Fc epsilon RI signaling pathway, TNF signaling pathway, Leukocyte transendothelial migration, Neurotrophin signaling pathway, Inflammatory mediator regulation of TRP channels, GnRH signaling pathway, Prolactin signaling pathway, Relaxin signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Growth hormone synthesis, secretion and action, Alcoholic liver disease, Epithelial cell signaling in Helicobacter pylori infection, Pathogenic Escherichia coli infection, Pertussis, Yersinia infection, Leishmaniasis, Chagas disease, Toxoplasmosis, Tuberculosis, Hepatitis B, Human cytomegalovirus infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Proteoglycans in cancer, PD-L1 expression and PD-1 checkpoint pathway in cancer, Lipid and atherosclerosis, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSMUSG00000022610, ENSBTAG00000019574, ENSCAFG00845005996, ENSG00000188130
    Target Classification Kinase


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.