Human CD3D/CD3-DELTA/CD3DELTA ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_000732.6)
Cat. No.: pGMPC001048
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CD3D/CD3-DELTA/CD3DELTA Non-Viral expression plasmid (overexpression vector) for mouse CD3D overexpression in unique cell transient transfection and stable cell line development.
Go to
CD3 Delta/CD3D/CD3d/CD3D/CD3-DELTA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC001048 |
| Gene Name | CD3D |
| Accession Number | NM_000732.6 |
| Gene ID | 915 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 516 bp |
| Gene Alias | CD3-DELTA,CD3DELTA,IMD19,T3D |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGAACATAGCACGTTTCTCTCTGGCCTGGTACTGGCTACCCTTCTCTCGCAAGTGAGCCCCTTCAAGATACCTATAGAGGAACTTGAGGACAGAGTGTTTGTGAATTGCAATACCAGCATCACATGGGTAGAGGGAACGGTGGGAACACTGCTCTCAGACATTACAAGACTGGACCTGGGAAAACGCATCCTGGACCCACGAGGAATATATAGGTGTAATGGGACAGATATATACAAGGACAAAGAATCTACCGTGCAAGTTCATTATCGAATGTGCCAGAGCTGTGTGGAGCTGGATCCAGCCACCGTGGCTGGCATCATTGTCACTGATGTCATTGCCACTCTGCTCCTTGCTTTGGGAGTCTTCTGCTTTGCTGGACATGAGACTGGAAGGCTGTCTGGGGCTGCCGACACACAAGCTCTGTTGAGGAATGACCAGGTCTATCAGCCCCTCCGAGATCGAGATGATGCTCAGTACAGCCACCTTGGAGGAAACTGGGCTCGGAACAAGTGA |
| ORF Protein Sequence | MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP0211-Ab | Anti-CD3D/ CD3-DELTA/ IMD19 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP0211-Ag | CD3D VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000460 | Human CD3D Lentivirus plasmid |
| ORF Viral Vector | pGMAP000294 | Human CD3D Adenovirus plasmid |
| ORF Viral Vector | pGMPC001048 | Human CD3D Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000460 | Human CD3D Lentivirus particle |
| ORF Viral Vector | vGMAP000294 | Human CD3D Adenovirus particle |
Target information
| Target ID | GM-MP0211 |
| Target Name | CD3 Delta/CD3D/CD3d |
|
Gene Group Identifier (Target Gene ID in Homo species) |
915 |
| Gene ID |
100062931 (Equus caballus), 101083107 (Felis catus), 12500 (Mus musculus), 25710 (Rattus norvegicus) 281053 (Bos taurus), 479419 (Canis lupus familiaris), 699582 (Macaca mulatta), 915 (Homo sapiens) |
| Gene Symbols & Synonyms | CD3D,Cd3d,T3d,T3D,IMD19,CD3DELTA,CD3-DELTA |
| Target Alternative Names | CD3 Delta,CD3-DELTA,CD3D,CD3DELTA,CD3d,Cd3d,IMD19,T-cell receptor T3 delta chain,T-cell surface glycoprotein CD3 delta chain,T3D,T3d |
| Uniprot Accession |
P04234,P04235,P19377,Q28072
Additional SwissProt Accessions: P04235,P19377,Q28072,P04234 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | |
| Disease | cancer |
| Disease from KEGG | Hematopoietic cell lineage, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Chagas disease, Measles, Human T-cell leukemia virus 1 infection, Epstein-Barr virus infection, PD-L1 expression and PD-1 checkpoint pathway in cancer |
| Gene Ensembl | ENSECAG00000018190, ENSMUSG00000032094, ENSBTAG00000006452, ENSCAFG00845002450, ENSMMUG00000049268, ENSG00000167286 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


