Human SRSF3/SFRS3/SRp20 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_003017)
Cat. No.: pGMPC000966
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SRSF3/SFRS3/SRp20 Non-Viral expression plasmid (overexpression vector) for mouse SRSF3 overexpression in unique cell transient transfection and stable cell line development.
Go to
SRp20/SRSF3/SRSF3/SFRS3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMPC000966 |
Gene Name | SRSF3 |
Accession Number | NM_003017 |
Gene ID | 6428 |
Species | Human |
Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
Insert Length | 495 bp |
Gene Alias | SFRS3,SRp20 |
Fluorescent Reporter | Null |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCATCGTGATTCCTGTCCATTGGACTGTAAGGTTTATGTAGGCAATCTTGGAAACAATGGCAACAAGACGGAATTGGAACGGGCTTTTGGCTACTATGGACCACTCCGAAGTGTGTGGGTTGCTAGAAACCCACCCGGCTTTGCTTTTGTTGAATTTGAAGATCCCCGAGATGCAGCTGATGCAGTCCGAGAGCTAGATGGAAGAACACTATGTGGCTGCCGTGTAAGAGTGGAACTGTCGAATGGTGAAAAAAGAAGTAGAAATCGTGGCCCACCTCCCTCTTGGGGTCGTCGCCCTCGAGATGATTATCGTAGGAGGAGTCCTCCACCTCGTCGCAGATCTCCAAGAAGGAGAAGCTTCTCTCGCAGCCGGAGCAGGTCCCTTTCTAGAGATAGGAGAAGAGAGAGATCGCTGTCTCGGGAGAGAAATCACAAGCCGTCCCGATCCTTCTCTAGGTCTCGTAGTCGATCTAGGTCAAATGAAAGGAAATAG |
ORF Protein Sequence | MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1820-Ab | Anti-SRSF3 monoclonal antibody |
Target Antigen | GM-Tg-g-IP1820-Ag | SRSF3 protein |
ORF Viral Vector | pGMLP000996 | Human SRSF3 Lentivirus plasmid |
ORF Viral Vector | pGMPC000966 | Human SRSF3 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP000996 | Human SRSF3 Lentivirus particle |
Target information
Target ID | GM-IP1820 |
Target Name | SRp20/SRSF3 |
Gene Group Identifier (Target Gene ID in Homo species) |
6428 |
Gene ID |
100053744 (Equus caballus), 101081223 (Felis catus), 20383 (Mus musculus), 361814 (Rattus norvegicus) 403687 (Canis lupus familiaris), 540276 (Bos taurus), 6428 (Homo sapiens), 719123 (Macaca mulatta) |
Gene Symbols & Synonyms | SRSF3,Srsf3,X16,Sfrs3,SFRS3,SRP20,SRp20 |
Target Alternative Names | Pre-mRNA-splicing factor SRP20,SFRS3,SRP20,SRSF3,SRp20,Serine/arginine-rich splicing factor 3,Sfrs3,Splicing factor,Srsf3,X16,arginine/serine-rich 3 |
Uniprot Accession |
P84103,P84104,Q3SZR8
Additional SwissProt Accessions: P84104,Q3SZR8,P84103 |
Uniprot Entry Name | |
Protein Sub-location | Introcelluar Protein |
Category | |
Disease | cancer |
Disease from KEGG | |
Gene Ensembl | ENSECAG00000018741, ENSMUSG00000071172, ENSCAFG00845009568, ENSBTAG00000040006, ENSG00000112081 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.