Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human ISG15/G1P2/hUCRP ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_005101.4)
Cat. No.: pGMPC000948
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human ISG15/G1P2/hUCRP Non-Viral expression plasmid (overexpression vector) for mouse ISG15 overexpression in unique cell transient transfection and stable cell line development.
Datasheet
Go to
ISG15/G1P2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC000948 |
| Gene Name | ISG15 |
| Accession Number | NM_005101.4 |
| Gene ID | 9636 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 498 bp |
| Gene Alias | G1P2,hUCRP,IFI15,IMD38,IP17,UCRP |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | MYC (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGGCTGGGACCTGACGGTGAAGATGCTGGCGGGCAACGAATTCCAGGTGTCCCTGAGCAGCTCCATGTCGGTGTCAGAGCTGAAGGCGCAGATCACCCAGAAGATCGGCGTGCACGCCTTCCAGCAGCGTCTGGCTGTCCACCCGAGCGGTGTGGCGCTGCAGGACAGGGTCCCCCTTGCCAGCCAGGGCCTGGGCCCCGGCAGCACGGTCCTGCTGGTGGTGGACAAATGCGACGAACCTCTGAGCATCCTGGTGAGGAATAACAAGGGCCGCAGCAGCACCTACGAGGTACGGCTGACGCAGACCGTGGCCCACCTGAAGCAGCAAGTGAGCGGGCTGGAGGGTGTGCAGGACGACCTGTTCTGGCTGACCTTCGAGGGGAAGCCCCTGGAGGACCAGCTCCCGCTGGGGGAGTACGGCCTCAAGCCCCTGAGCACCGTGTTCATGAATCTGCGCCTGCGGGGAGGCGGCACAGAGCCTGGCGGGCGGAGCTAA |
| ORF Protein Sequence | MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1038-Ab | Anti-ISG15/ G1P2/ IFI15 functional antibody |
| Target Antigen | GM-Tg-g-SE1038-Ag | ISG15 protein |
| ORF Viral Vector | pGMLP003914 | Human ISG15 Lentivirus plasmid |
| ORF Viral Vector | pGMLP003916 | Human ISG15 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001459 | Human ISG15 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002495 | Human ISG15 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000080 | Human ISG15 Adenovirus plasmid |
| ORF Viral Vector | pGMPC000948 | Human ISG15 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP003914 | Human ISG15 Lentivirus particle |
| ORF Viral Vector | vGMLP003916 | Human ISG15 Lentivirus particle |
| ORF Viral Vector | vGMLV001459 | Human ISG15 Lentivirus particle |
| ORF Viral Vector | vGMLV002495 | Human ISG15 Lentivirus particle |
| ORF Viral Vector | vGMAP000080 | Human ISG15 Adenovirus particle |
Target information
| Target ID | GM-SE1038 |
| Target Name | ISG15 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
9636 |
| Gene ID |
100038882 (Mus musculus), 100066364 (Equus caballus), 100174787 (Felis catus), 100855667 (Canis lupus familiaris) 281871 (Bos taurus), 298693 (Rattus norvegicus), 700141 (Macaca mulatta), 9636 (Homo sapiens) |
| Gene Symbols & Synonyms | Isg15,ISG15,G1p2,IP17,Irfp,UCRP,IGI15,G1P2,IFI15,IMD38,hUCRP |
| Target Alternative Names | G1P2,G1p2,IFI15,IGI15,IMD38,IP17,ISG15,Interferon-induced 15 kDa protein,Interferon-induced 17 kDa protein (IP17),Irfp,Isg15,UCRP,Ubiquitin cross-reactive protein (hUCRP),Ubiquitin-like protein ISG15,hUCRP |
| Uniprot Accession |
O02741,P05161,Q64339
Additional SwissProt Accessions: Q64339,O02741,P05161 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | |
| Disease | cancer |
| Disease from KEGG | RIG-I-like receptor signaling pathway, Human papillomavirus infection, Epstein-Barr virus infection |
| Gene Ensembl | ENSMUSG00000035692, ENSECAG00000059003, ENSCAFG00845020316, ENSBTAG00000014707, ENSMMUG00000050757, ENSG00000187608 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.