Human BCL2/Bcl-2/PPP1R50 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_000657.3)
Cat. No.: pGMPC000848
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human BCL2/Bcl-2/PPP1R50 Non-Viral expression plasmid (overexpression vector) for mouse BCL2 overexpression in unique cell transient transfection and stable cell line development.
Go to
BCL2/BCL-2/BCL2/Bcl-2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC000848 |
| Gene Name | BCL2 |
| Accession Number | NM_000657.3 |
| Gene ID | 596 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 618 bp |
| Gene Alias | Bcl-2,PPP1R50 |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGCACGCTGGGAGAACAGGGTACGATAACCGGGAGATAGTGATGAAGTACATCCATTATAAGCTGTCGCAGAGGGGCTACGAGTGGGATGCGGGAGATGTGGGCGCCGCGCCCCCGGGGGCCGCCCCCGCACCGGGCATCTTCTCCTCCCAGCCCGGGCACACGCCCCATCCAGCCGCATCCCGGGACCCGGTCGCCAGGACCTCGCCGCTGCAGACCCCGGCTGCCCCCGGCGCCGCCGCGGGGCCTGCGCTCAGCCCGGTGCCACCTGTGGTCCACCTGACCCTCCGCCAGGCCGGCGACGACTTCTCCCGCCGCTACCGCCGCGACTTCGCCGAGATGTCCAGCCAGCTGCACCTGACGCCCTTCACCGCGCGGGGACGCTTTGCCACGGTGGTGGAGGAGCTCTTCAGGGACGGGGTGAACTGGGGGAGGATTGTGGCCTTCTTTGAGTTCGGTGGGGTCATGTGTGTGGAGAGCGTCAACCGGGAGATGTCGCCCCTGGTGGACAACATCGCCCTGTGGATGACTGAGTACCTGAACCGGCACCTGCACACCTGGATCCAGGATAACGGAGGCTGGGTAGGTGCACTTGGTGATGTGAGTCTGGGCTGA |
| ORF Protein Sequence | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWVGALGDVSLG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0014-Ab | Anti-BCL-2 monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0014-Ag | BCL-2/BCL2 protein |
| ORF Viral Vector | pGMLP002721 | Human BCL2 Lentivirus plasmid |
| ORF Viral Vector | pGMLP005806 | Human BCL2 Lentivirus plasmid |
| ORF Viral Vector | pGMLP-SPh-016 | Human BCL2 Lentivirus plasmid |
| ORF Viral Vector | pGMAP-SPh-156 | Human BCL2 Adenovirus plasmid |
| ORF Viral Vector | pGMPC000248 | Human BCL2 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC000848 | Human BCL2 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP002721 | Human BCL2 Lentivirus particle |
| ORF Viral Vector | vGMLP005806 | Human BCL2 Lentivirus particle |
| ORF Viral Vector | vGMLP-SPh-016 | Human BCL2 Lentivirus particle |
| ORF Viral Vector | vGMAP-SPh-156 | Human BCL2 Adenovirus particle |
Target information
| Target ID | GM-IP0014 |
| Target Name | BCL2/BCL-2 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
596 |
| Gene ID |
100050934 (Equus caballus), 12043 (Mus musculus), 24224 (Rattus norvegicus), 281020 (Bos taurus) 403416 (Canis lupus familiaris), 493934 (Felis catus), 596 (Homo sapiens), 707407 (Macaca mulatta) |
| Gene Symbols & Synonyms | BCL2,Bcl2,Bcl-2,C430015F12Rik,D630044D05Rik,D830018M01Rik,BCL-2,bcl-2,PPP1R50 |
| Target Alternative Names | Apoptosis regulator Bcl-2,BCL-2,BCL2,Bcl-2,Bcl2,C430015F12Rik,D630044D05Rik,D830018M01Rik,PPP1R50,bcl-2 |
| Uniprot Accession |
O02718,P10415,P10417,P49950,Q6R755
Additional SwissProt Accessions: P10417,P49950,O02718,Q6R755,P10415 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target, Immuno-oncology Target |
| Disease | cancer, Breast Cancer, immune cells or tumors |
| Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, Endocrine resistance, NF-kappa B signaling pathway, HIF-1 signaling pathway, Sphingolipid signaling pathway, p53 signaling pathway, Protein processing in endoplasmic reticulum, PI3K-Akt signaling pathway, Apoptosis, Apoptosis - multiple species, Adrenergic signaling in cardiomyocytes, Focal adhesion, NOD-like receptor signaling pathway, JAK-STAT signaling pathway, Neurotrophin signaling pathway, Cholinergic synapse, Parathyroid hormone synthesis, secretion and action, AGE-RAGE signaling pathway in diabetic complications, Toxoplasmosis, Tuberculosis, Hepatitis B, Measles, Epstein-Barr virus infection, Pathways in cancer, Chemical carcinogenesis - receptor activation, Colorectal cancer, Prostate cancer, Small cell lung cancer, Gastric cancer, Lipid and atherosclerosis, Fluid shear stress and atherosclerosis |
| Gene Ensembl | ENSECAG00000020437, ENSMUSG00000057329, ENSBTAG00000019302, ENSCAFG00845002725, ENSG00000171791, ENSMMUG00000059194 |
| Target Classification | Pathway, Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


