Human MMP7/MMP-7/MPSL1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002423.5)

Cat. No.: pGMPC000761
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MMP7/MMP-7/MPSL1 Non-Viral expression plasmid (overexpression vector) for mouse MMP7 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to MMP7/MMP-7/MMP7/MMP-7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000761
Gene Name MMP7
Accession Number NM_002423.5
Gene ID 4316
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 804 bp
Gene Alias MMP-7,MPSL1,PUMP-1
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGCGACTCACCGTGCTGTGTGCTGTGTGCCTGCTGCCTGGCAGCCTGGCCCTGCCGCTGCCTCAGGAGGCGGGAGGCATGAGTGAGCTACAGTGGGAACAGGCTCAGGACTATCTCAAGAGATTTTATCTCTATGACTCAGAAACAAAAAATGCCAACAGTTTAGAAGCCAAACTCAAGGAGATGCAAAAATTCTTTGGCCTACCTATAACTGGAATGTTAAACTCCCGCGTCATAGAAATAATGCAGAAGCCCAGATGTGGAGTGCCAGATGTTGCAGAATACTCACTATTTCCAAATAGCCCAAAATGGACTTCCAAAGTGGTCACCTACAGGATCGTATCATATACTCGAGACTTACCGCATATTACAGTGGATCGATTAGTGTCAAAGGCTTTAAACATGTGGGGCAAAGAGATCCCCCTGCATTTCAGGAAAGTTGTATGGGGAACTGCTGACATCATGATTGGCTTTGCGCGAGGAGCTCATGGGGACTCCTACCCATTTGATGGGCCAGGAAACACGCTGGCTCATGCCTTTGCGCCTGGGACAGGTCTCGGAGGAGATGCTCACTTCGATGAGGATGAACGCTGGACGGATGGTAGCAGTCTAGGGATTAACTTCCTGTATGCTGCAACTCATGAACTTGGCCATTCTTTGGGTATGGGACATTCCTCTGATCCTAATGCAGTGATGTATCCAACCTATGGAAATGGAGATCCCCAAAATTTTAAACTTTCCCAGGATGATATTAAAGGCATTCAGAAACTATATGGAAAGAGAAGTAATTCAAGAAAGAAATAG
ORF Protein Sequence MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T73475-Ab Anti-MMP7/ MMP-7/ MPSL1 functional antibody
    Target Antigen GM-Tg-g-T73475-Ag MMP-7/MMP7 protein
    ORF Viral Vector pGMLP003953 Human MMP7 Lentivirus plasmid
    ORF Viral Vector pGMLV002265 Human MMP7 Lentivirus plasmid
    ORF Viral Vector pGMPC000761 Human MMP7 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003953 Human MMP7 Lentivirus particle
    ORF Viral Vector vGMLV002265 Human MMP7 Lentivirus particle


    Target information

    Target ID GM-T73475
    Target Name MMP7/MMP-7
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4316
    Gene ID 100068985 (Equus caballus), 17393 (Mus musculus), 25335 (Rattus norvegicus), 286794 (Bos taurus)
    4316 (Homo sapiens), 489432 (Canis lupus familiaris), 703072 (Macaca mulatta), 727698 (Felis catus)
    Gene Symbols & Synonyms MMP7,Mmp7,MAT,MMP-7,MPMM,MPSL1,PUMP-1,Matrilysin
    Target Alternative Names MAT,MMP-7,MMP7,MPMM,MPSL1,Matrilysin,Matrin,Matrix metalloproteinase-7 (MMP-7),Mmp7,PUMP-1,Pump-1 protease,Uterine metalloproteinase
    Uniprot Accession P09237,P50280,P55032,Q10738
    Additional SwissProt Accessions: Q10738,P50280,P09237,P55032
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer, Ovary Cancer, Chronic Kidney Disease
    Disease from KEGG Wnt signaling pathway, Human T-cell leukemia virus 1 infection
    Gene Ensembl ENSECAG00000021262, ENSMUSG00000018623, ENSBTAG00000004594, ENSG00000137673, ENSCAFG00845000992, ENSMMUG00000003405
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.