Human ATF4/CREB-2/CREB2 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001675)

Cat. No.: pGMPC000693
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ATF4/CREB-2/CREB2 Non-Viral expression plasmid (overexpression vector) for mouse ATF4 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to ATF4/ATF-4/ATF4/CREB-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000693
Gene Name ATF4
Accession Number NM_001675
Gene ID 468
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 1056 bp
Gene Alias CREB-2,CREB2,TAXREB67,TXREB
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCGAAATGAGCTTCCTGAGCAGCGAGGTGTTGGTGGGGGACTTGATGTCCCCCTTCGACCAGTCGGGTTTGGGGGCTGAAGAAAGCCTAGGTCTCTTAGATGATTACCTGGAGGTGGCCAAGCACTTCAAACCTCATGGGTTCTCCAGCGACAAGGCTAAGGCGGGCTCCTCCGAATGGCTGGCTGTGGATGGGTTGGTCAGTCCCTCCAACAACAGCAAGGAGGATGCCTTCTCCGGGACAGATTGGATGTTGGAGAAAATGGATTTGAAGGAGTTCGACTTGGATGCCCTGTTGGGTATAGATGACCTGGAAACCATGCCAGATGACCTTCTGACCACGTTGGATGACACTTGTGATCTCTTTGCCCCCCTAGTCCAGGAGACTAATAAGCAGCCCCCCCAGACGGTGAACCCAATTGGCCATCTCCCAGAAAGTTTAACAAAACCCGACCAGGTTGCCCCCTTCACCTTCTTACAACCTCTTCCCCTTTCCCCAGGGGTCCTGTCCTCCACTCCAGATCATTCCTTTAGTTTAGAGCTGGGCAGTGAAGTGGATATCACTGAAGGAGATAGGAAGCCAGACTACACTGCTTACGTTGCCATGATCCCTCAGTGCATAAAGGAGGAAGACACCCCTTCAGATAATGATAGTGGCATCTGTATGAGCCCAGAGTCCTATCTGGGGTCTCCTCAGCACAGCCCCTCTACCAGGGGCTCTCCAAATAGGAGCCTCCCATCTCCAGGTGTTCTCTGTGGGTCTGCCCGTCCCAAACCTTACGATCCTCCTGGAGAGAAGATGGTAGCAGCAAAAGTAAAGGGTGAGAAACTGGATAAGAAGCTGAAAAAAATGGAGCAAAACAAGACAGCAGCCACTAGGTACCGCCAGAAGAAGAGGGCGGAGCAGGAGGCTCTTACTGGTGAGTGCAAAGAGCTGGAAAAGAAGAACGAGGCTCTAAAAGAGAGGGCGGATTCCCTGGCCAAGGAGATCCAGTACCTGAAAGATTTGATAGAAGAGGTCCGCAAGGCAAGGGGGAAGAAAAGGGTCCCCTAG
ORF Protein Sequence MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T53270-Ab Anti-ATF-4 monoclonal antibody
    Target Antigen GM-Tg-g-T53270-Ag ATF-4/ATF4 protein
    ORF Viral Vector pGMLV000321 Human ATF4 Lentivirus plasmid
    ORF Viral Vector pGMLV000496 Human ATF4 Lentivirus plasmid
    ORF Viral Vector pGMPC000693 Human ATF4 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001314 Human ATF4 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV000321 Human ATF4 Lentivirus particle
    ORF Viral Vector vGMLV000496 Human ATF4 Lentivirus particle


    Target information

    Target ID GM-T53270
    Target Name ATF4/ATF-4
    Gene Group Identifier
    (Target Gene ID in Homo species)
    468
    Gene ID 100070334 (Equus caballus), 101084297 (Felis catus), 11911 (Mus musculus), 468 (Homo sapiens)
    474503 (Canis lupus familiaris), 509107 (Bos taurus), 703965 (Macaca mulatta), 79255 (Rattus norvegicus)
    Gene Symbols & Synonyms ATF4,Atf4,Atf-4,C/ATF,CREB2,CREB-2,TAXREB67,TXREB
    Target Alternative Names ATF-4,ATF4,Activating transcription factor 4,Atf-4,Atf4,C/ATF,CREB-2,CREB2,Cyclic AMP-dependent transcription factor ATF-4,Cyclic AMP-responsive element-binding protein 2 (CREB-2,TAXREB67,TXREB,Tax-responsive enhancer element-binding protein 67 (TaxREB67),cAMP-dependent transcription factor ATF-4,cAMP-responsive element-binding protein 2)
    Uniprot Accession P18848,Q06507,Q3ZCH6,Q9ES19
    Additional SwissProt Accessions: Q06507,P18848,Q3ZCH6,Q9ES19
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG MAPK signaling pathway, cGMP-PKG signaling pathway, Protein processing in endoplasmic reticulum, PI3K-Akt signaling pathway, Apoptosis, Longevity regulating pathway, Adrenergic signaling in cardiomyocytes, TNF signaling pathway, Long-term potentiation, Neurotrophin signaling pathway, Cholinergic synapse, Insulin secretion, GnRH signaling pathway, Thyroid hormone synthesis, Aldosterone synthesis and secretion, Relaxin signaling pathway, Cortisol synthesis and secretion, Parathyroid hormone synthesis, secretion and action, Cushing syndrome, Growth hormone synthesis, secretion and action, Alzheimer disease, Cocaine addiction, Amphetamine addiction, Hepatitis B, Human cytomegalovirus infection, Human T-cell leukemia virus 1 infection, Chemical carcinogenesis - receptor activation, Prostate cancer, Lipid and atherosclerosis
    Gene Ensembl ENSMUSG00000042406, ENSG00000128272, ENSCAFG00845021497, ENSBTAG00000017462, ENSMMUG00000055780
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.