Human CD9/BTCC-1/DRAP-27 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001769.4)

Cat. No.: pGMPC000682
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD9/BTCC-1/DRAP-27 Non-Viral expression plasmid (overexpression vector) for mouse CD9 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to CD9/BTCC-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000682
Gene Name CD9
Accession Number NM_001769.4
Gene ID 928
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 687 bp
Gene Alias BTCC-1,DRAP-27,MIC3,MRP-1,TSPAN-29,TSPAN29
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCCGGTCAAAGGAGGCACCAAGTGCATCAAATACCTGCTGTTCGGATTTAACTTCATCTTCTGGCTTGCCGGGATTGCTGTCCTTGCCATTGGACTATGGCTCCGATTCGACTCTCAGACCAAGAGCATCTTCGAGCAAGAAACTAATAATAATAATTCCAGCTTCTACACAGGAGTCTATATTCTGATCGGAGCCGGCGCCCTCATGATGCTGGTGGGCTTCCTGGGCTGCTGCGGGGCTGTGCAGGAGTCCCAGTGCATGCTGGGACTGTTCTTCGGCTTCCTCTTGGTGATATTCGCCATTGAAATAGCTGCGGCCATCTGGGGATATTCCCACAAGGATGAGGTGATTAAGGAAGTCCAGGAGTTTTACAAGGACACCTACAACAAGCTGAAAACCAAGGATGAGCCCCAGCGGGAAACGCTGAAAGCCATCCACTATGCGTTGAACTGCTGTGGTTTGGCTGGGGGCGTGGAACAGTTTATCTCAGACATCTGCCCCAAGAAGGACGTACTCGAAACCTTCACCGTGAAGTCCTGTCCTGATGCCATCAAAGAGGTCTTCGACAATAAATTCCACATCATCGGCGCAGTGGGCATCGGCATTGCCGTGGTCATGATATTTGGCATGATCTTCAGTATGATCTTGTGCTGTGCTATCCGCAGGAACCGCGAGATGGTCTAG
ORF Protein Sequence MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T50574-Ab Anti-CD9/ BTCC-1/ DRAP-27 monoclonal antibody
    Target Antigen GM-Tg-g-T50574-Ag CD9 VLP (virus-like particle)
    ORF Viral Vector pGMAP000191 Human CD9 Adenovirus plasmid
    ORF Viral Vector pGMPC000682 Human CD9 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMAP000191 Human CD9 Adenovirus particle


    Target information

    Target ID GM-T50574
    Target Name CD9
    Gene Group Identifier
    (Target Gene ID in Homo species)
    928
    Gene ID 100059512 (Equus caballus), 12527 (Mus musculus), 24936 (Rattus norvegicus), 280746 (Bos taurus)
    493874 (Felis catus), 611695 (Canis lupus familiaris), 712262 (Macaca mulatta), 928 (Homo sapiens)
    Gene Symbols & Synonyms CD9,Cd9,Tspan29,MIC3,MRP-1,BTCC-1,DRAP-27,TSPAN29,TSPAN-29
    Target Alternative Names 5H9 antigen,BTCC-1,CD9,CD9 antigen,Cd9,Cell growth-inhibiting gene 2 protein,DRAP-27,Leukocyte antigen MIC3,MIC3,MRP-1,Motility-related protein (MRP-1),TSPAN-29,TSPAN29,Tetraspanin-29 (Tspan-29),Tspan29,p24
    Uniprot Accession P21926,P30932,P40239,P40240,P40241
    Additional SwissProt Accessions: P40240,P40241,P30932,P40239,P21926
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease cancer
    Disease from KEGG Hematopoietic cell lineage
    Gene Ensembl ENSECAG00000003002, ENSMUSG00000030342, ENSBTAG00000014764, ENSCAFG00845029613, ENSMMUG00000004470, ENSG00000010278
    Target Classification Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.