Human GPX4/GPx-4/GSHPx-4 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002085.5)
Cat. No.: pGMPC000647
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human GPX4/GPx-4/GSHPx-4 Non-Viral expression plasmid (overexpression vector) for mouse GPX4 overexpression in unique cell transient transfection and stable cell line development.
Go to
GPX4/GPx-4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC000647 |
| Gene Name | GPX4 |
| Accession Number | NM_002085.5 |
| Gene ID | 2879 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 594 bp |
| Gene Alias | GPx-4,GSHPx-4,MCSP,PHGPx,SMDS,snGPx,snPHGPx |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGCCTCGGCCGCCTTTGCCGCCTACTGAAGCCGGCGCTGCTCTGTGGGGCTCTGGCCGCGCCTGGCCTGGCCGGGACCATGTGCGCGTCCCGGGACGACTGGCGCTGTGCGCGCTCCATGCACGAGTTTTCCGCCAAGGACATCGACGGGCACATGGTTAACCTGGACAAGTACCGGGGCTTCGTGTGCATCGTCACCAACGTGGCCTCCCAGTGAGGCAAGACCGAAGTAAACTACACTCAGCTCGTCGACCTGCACGCCCGATACGCTGAGTGTGGTTTGCGGATCCTGGCCTTCCCGTGTAACCAGTTCGGGAAGCAGGAGCCAGGGAGTAACGAAGAGATCAAAGAGTTCGCCGCGGGCTACAACGTCAAATTCGATATGTTCAGCAAGATCTGCGTGAACGGGGACGACGCCCACCCGCTGTGGAAGTGGATGAAGATCCAACCCAAGGGCAAGGGCATCCTGGGAAATGCCATCAAGTGGAACTTCACCAAGTTCCTCATCGACAAGAACGGCTGCGTGGTGAAGCGCTACGGACCCATGGAGGAGCCCCTGGTGATAGAGAAGGACCTGCCCCACTATTTCTAG |
| ORF Protein Sequence | MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1581-Ab | Anti-GPX4/ GPx-4/ GSHPx-4 functional antibody |
| Target Antigen | GM-Tg-g-SE1581-Ag | GPX4 protein |
| ORF Viral Vector | pGMLP003326 | Human GPX4 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001745 | Human GPX4 Lentivirus plasmid |
| ORF Viral Vector | pGMAAV001492 | Human GPX4 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | pGMPC000647 | Human GPX4 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC001494 | Human GPX4 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP003326 | Human GPX4 Lentivirus particle |
| ORF Viral Vector | vGMLV001745 | Human GPX4 Lentivirus particle |
| ORF Viral Vector | vGMAAV001492 | Human GPX4 Adeno-associate virus(AAV) particle |
Target information
| Target ID | GM-SE1581 |
| Target Name | GPX4 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
2879 |
| Gene ID |
101095956 (Felis catus), 102147383 (Equus caballus), 119864793 (Canis lupus familiaris), 286809 (Bos taurus) 2879 (Homo sapiens), 29328 (Rattus norvegicus), 625249 (Mus musculus), 705333 (Macaca mulatta) |
| Gene Symbols & Synonyms | GPX4,Gpx4,PHGPx,MCSP,SMDS,GPx-4,snGPx,GSHPx-4,snPHGPx,Phgpx,gpx-4,snGpx,Gshpx-4,mtPHGPx |
| Target Alternative Names | GPX4,GPx-4,GSHPx-4,GSHPx-4),Glutathione peroxidase 4 (GPx-4,Gpx4,Gshpx-4,MCSP,PHGPx,Phgpx,Phospholipid hydroperoxide glutathione peroxidase GPX4,SMDS,gpx-4,mtPHGPx,snGPx,snGpx,snPHGPx |
| Uniprot Accession |
O70325,P36969,P36970,Q9N2J2
Additional SwissProt Accessions: Q9N2J2,P36969,P36970,O70325 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | |
| Disease | |
| Disease from KEGG | Metabolic pathways, Ferroptosis |
| Gene Ensembl | ENSECAG00000035469, ENSCAFG00845013423, ENSBTAG00000053003, ENSG00000167468, ENSMUSG00000075706, ENSMMUG00000028946 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


