Human SLC25A51/CG7943/MCART1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_033412.4)

Cat. No.: pGMPC000546
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SLC25A51/CG7943/MCART1 Non-Viral expression plasmid (overexpression vector) for mouse SLC25A51 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to SLC25A51/CG7943 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000546
Gene Name SLC25A51
Accession Number NM_033412.4
Gene ID 92014
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 894 bp
Gene Alias CG7943,MCART1
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATGGATTCAGAAGCTCATGAAAAGAGGCCACCAATACTAACATCTTCAAAACAAGATATATCACCTCATATTACAAATGTTGGTGAGATGAAGCATTACTTGTGTGGCTGCTGTGCAGCCTTCAACAATGTCGCAATCACATTTCCCATTCAGAAGGTCCTCTTTCGACAACAGCTGTATGGCATCAAAACCCGGGATGCAATACTTCAGTTGAGAAGGGATGGATTTCGAAATTTGTATCGTGGAATCCTTCCCCCATTGATGCAGAAGACAACTACGCTTGCACTTATGTTTGGTCTGTATGAGGATTTATCCTGCCTTCTCCACAAGCATGTCAGTGCTCCAGAGTTTGCAACCAGTGGCGTGGCGGCAGTGCTTGCAGGGACAACAGAAGCAATTTTCACTCCACTGGAAAGAGTTCAGACATTGCTTCAAGACCACAAGCATCATGACAAATTTACCAACACTTACCAGGCTTTCAAGGCACTGAAATGTCATGGAATTGGAGAGTATTATCGAGGCTTGGTGCCCATTCTTTTCCGGAATGGACTCAGCAATGTCTTGTTTTTCGGCCTTCGAGGTCCCATTAAGGAGCATCTGCCTACCGCAACGACTCACAGTGCTCATCTGGTCAATGATTTTATCTGTGGAGGTCTATTGGGTGCCATGTTGGGATTCTTGTTTTTTCCAATTAATGTTGTAAAAACTCGCATACAGTCTCAGATTGGTGGGGAATTTCAGTCTTTCCCCAAGGTTTTCCAAAAAATCTGGCTGGAACGGGACAGAAAACTGATAAATCTTTTCAGAGGTGCCCATCTGAATTACCATCGGTCCCTCATCTCTTGGGGCATAATCAATGCAACTTATGAGTTCTTGTTAAAGGTTATATGA
ORF Protein Sequence MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLHKHVSAPEFATSGVAAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFICGGLLGAMLGFLFFPINVVKTRIQSQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKVI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1689-Ab Anti-SLC25A51 monoclonal antibody
    Target Antigen GM-Tg-g-IP1689-Ag SLC25A51 protein
    ORF Viral Vector pGMPC000546 Human SLC25A51 Mammalian (Non-Viral Vector) plasmid


    Target information

    Target ID GM-IP1689
    Target Name SLC25A51
    Gene Group Identifier
    (Target Gene ID in Homo species)
    92014
    Gene ID 100066182 (Equus caballus), 100686420 (Canis lupus familiaris), 101081580 (Felis catus), 230125 (Mus musculus)
    313241 (Rattus norvegicus), 716206 (Macaca mulatta), 781425 (Bos taurus), 92014 (Homo sapiens)
    Gene Symbols & Synonyms SLC25A51,Slc25a51,Gm138,Mcart1,9130208E07Rik,D130005A03Rik,MCART1,CG7943
    Target Alternative Names SLC25A51,Mitochondrial nicotinamide adenine dinucleotide transporter SLC25A51,Mitochondrial NAD(+) transporter SLC25A51, Mitochondrial carrier triple repeat protein 1, Solute carrier family 25 member 51,CG7943,MCART1
    Uniprot Accession Q52KK3,Q5HZI9,Q9H1U9
    Additional SwissProt Accessions: Q5HZI9,Q52KK3,Q9H1U9
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000042818, ENSCAFG00845014022, ENSMUSG00000045973, ENSMMUG00000052842, ENSBTAG00000014936, ENSG00000122696
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.