Human PPP1CA/PP-1A/PP1A ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002708)

Cat. No.: pGMPC000448
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PPP1CA/PP-1A/PP1A Non-Viral expression plasmid (overexpression vector) for mouse PPP1CA overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to PPP1CA/PP-1A products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000448
Gene Name PPP1CA
Accession Number NM_002708
Gene ID 5499
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 993 bp
Gene Alias PP-1A,PP1A,PP1alpha,PPP1A
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag MYC (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCCGACAGCGAGAAGCTCAACCTGGACTCGATCATCGGGCGCCTGCTGGAAGTGCAGGGCTCGCGGCCTGGCAAGAATGTACAGCTGACAGAGAACGAGATCCGCGGTCTGTGCCTGAAATCCCGGGAGATTTTTCTGAGCCAGCCCATTCTTCTGGAGCTGGAGGCACCCCTCAAGATCTGCGGTGACATACACGGCCAGTACTACGACCTTCTGCGACTATTTGAGTATGGCGGTTTCCCTCCCGAGAGCAACTACCTCTTTCTGGGGGACTATGTGGACAGGGGCAAGCAGTCCTTGGAGACCATCTGCCTGCTGCTGGCCTATAAGATCAAGTACCCCGAGAACTTCTTCCTGCTCCGTGGGAACCACGAGTGTGCCAGCATCAACCGCATCTATGGTTTCTACGATGAGTGCAAGAGACGCTACAACATCAAACTGTGGAAAACCTTCACTGACTGCTTCAACTGCCTGCCCATCGCGGCCATAGTGGACGAAAAGATCTTCTGCTGCCACGGAGGCCTGTCCCCGGACCTGCAGTCTATGGAGCAGATTCGGCGGATCATGCGGCCCACAGATGTGCCTGACCAGGGCCTGCTGTGTGACCTGCTGTGGTCTGACCCTGACAAGGACGTGCAGGGCTGGGGCGAGAACGACCGTGGCGTCTCTTTTACCTTTGGAGCCGAGGTGGTGGCCAAGTTCCTCCACAAGCACGACTTGGACCTCATCTGCCGAGCACACCAGGTGGTAGAAGACGGCTACGAGTTCTTTGCCAAGCGGCAGCTGGTGACACTTTTCTCAGCTCCCAACTACTGTGGCGAGTTTGACAATGCTGGCGCCATGATGAGTGTGGACGAGACCCTCATGTGCTCTTTCCAGATCCTCAAGCCCGCCGACAAGAACAAGGGGAAGTACGGGCAGTTCAGTGGCCTGAACCCTGGAGGCCGACCCATCACCCCACCCCGCAATTCCGCCAAAGCCAAGAAATAG
ORF Protein Sequence MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T59845-Ab Anti-PP1A/ PPP1CA/ PP-1A monoclonal antibody
    Target Antigen GM-Tg-g-T59845-Ag PPP1CA VLP (virus-like particle)
    ORF Viral Vector pGMLP000473 Human PPP1CA Lentivirus plasmid
    ORF Viral Vector pGMLP005601 Human PPP1CA Lentivirus plasmid
    ORF Viral Vector pGMAP000389 Human PPP1CA Adenovirus plasmid
    ORF Viral Vector pGMPC000448 Human PPP1CA Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000473 Human PPP1CA Lentivirus particle
    ORF Viral Vector vGMLP005601 Human PPP1CA Lentivirus particle
    ORF Viral Vector vGMAP000389 Human PPP1CA Adenovirus particle


    Target information

    Target ID GM-T59845
    Target Name PPP1CA
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5499
    Gene ID 100059233 (Equus caballus), 109492306 (Felis catus), 19045 (Mus musculus), 24668 (Rattus norvegicus)
    403609 (Canis lupus familiaris), 516175 (Bos taurus), 5499 (Homo sapiens), 721735 (Macaca mulatta)
    Gene Symbols & Synonyms PPP1CA,Ppp1ca,Ppp1c,dism2,PP1alpha,PP1A,PP-1A,PPP1A
    Target Alternative Names PPP1CA,Serine/threonine-protein phosphatase PP1-alpha catalytic subunit,PP-1A,PP1A,PP-1A,PPP1A,PP1alpha
    Uniprot Accession P62136,P62137,P62138,Q3T0E7,Q8WMS6
    Additional SwissProt Accessions: P62137,P62138,Q8WMS6,Q3T0E7,P62136
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG cGMP-PKG signaling pathway, cAMP signaling pathway, Cellular senescence, Adrenergic signaling in cardiomyocytes, Vascular smooth muscle contraction, Hippo signaling pathway, Focal adhesion, Platelet activation, Long-term potentiation, Inflammatory mediator regulation of TRP channels, Regulation of actin cytoskeleton, Oxytocin signaling pathway, Insulin resistance, Amphetamine addiction, Proteoglycans in cancer
    Gene Ensembl ENSECAG00000010532, ENSMUSG00000040385, ENSCAFG00845010538, ENSBTAG00000012146, ENSG00000172531, ENSMMUG00000017278
    Target Classification Kinase


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.