Human CAV1/BSCL3/CGL3 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001753.5)

Cat. No.: pGMPC000373
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CAV1/BSCL3/CGL3 Non-Viral expression plasmid (overexpression vector) for mouse CAV1 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to Caveolin-1/CAV1/CAV1/BSCL3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000373
Gene Name CAV1
Accession Number NM_001753.5
Gene ID 857
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 537 bp
Gene Alias BSCL3,CGL3,LCCNS,MSTP085,PPH3,VIP21
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGGGGGCAAATACGTAGACTCGGAGGGACATCTCTACACCGTTCCCATCCGGGAACAGGGCAACATCTACAAGCCCAACAACAAGGCCATGGCAGACGAGCTGAGCGAGAAGCAAGTGTACGACGCGCACACCAAGGAGATCGACCTGGTCAACCGCGACCCTAAACACCTCAACGATGACGTGGTCAAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAA
ORF Protein Sequence MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T93945-Ab Anti-CAV1/ BSCL3/ CGL3 monoclonal antibody
    Target Antigen GM-Tg-g-T93945-Ag CAV1 VLP (virus-like particle)
    ORF Viral Vector pGMLV000315 Human CAV1 Lentivirus plasmid
    ORF Viral Vector pGMLV000316 Human CAV1 Lentivirus plasmid
    ORF Viral Vector pGMAD001567 Human CAV1 Adenovirus plasmid
    ORF Viral Vector pGMAAV000856 Human CAV1 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAP000101 Human CAV1 Adenovirus plasmid
    ORF Viral Vector pGMPC000357 Human CAV1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC000373 Human CAV1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV000315 Human CAV1 Lentivirus particle
    ORF Viral Vector vGMLV000316 Human CAV1 Lentivirus particle
    ORF Viral Vector vGMAD001567 Human CAV1 Adenovirus particle
    ORF Viral Vector vGMAAV000856 Human CAV1 Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAP000101 Human CAV1 Adenovirus particle


    Target information

    Target ID GM-T93945
    Target Name Caveolin-1/CAV1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    857
    Gene ID 100055975 (Equus caballus), 12389 (Mus musculus), 25404 (Rattus norvegicus), 281040 (Bos taurus)
    403980 (Canis lupus familiaris), 493668 (Felis catus), 704449 (Macaca mulatta), 857 (Homo sapiens)
    Gene Symbols & Synonyms CAV1,Cav1,Cav,Cav-1,Caveolin-1,CGL3,PPH3,BSCL3,LCCNS,VIP21,MSTP085
    Target Alternative Names BSCL3,CAV1,CGL3,Cav,Cav-1,Cav1,Caveolin-1,LCCNS,MSTP085,PPH3,VIP21
    Uniprot Accession A0M8S7,P33724,P41350,P49817,P79132,Q03135,Q2QLB0
    Additional SwissProt Accessions: Q2QLB0,P49817,P41350,P79132,P33724,A0M8S7,Q03135
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease cancer, Prostate Cancer
    Disease from KEGG Focal adhesion, Proteoglycans in cancer, Viral myocarditis, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSMUSG00000007655, ENSCAFG00845006847, ENSMMUG00000014122, ENSG00000105974
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.