Human CAV1/BSCL3/CGL3 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001753.5)
Cat. No.: pGMPC000373
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CAV1/BSCL3/CGL3 Non-Viral expression plasmid (overexpression vector) for mouse CAV1 overexpression in unique cell transient transfection and stable cell line development.
Go to
Caveolin-1/CAV1/CAV1/BSCL3 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC000373 |
| Gene Name | CAV1 |
| Accession Number | NM_001753.5 |
| Gene ID | 857 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 537 bp |
| Gene Alias | BSCL3,CGL3,LCCNS,MSTP085,PPH3,VIP21 |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCTGGGGGCAAATACGTAGACTCGGAGGGACATCTCTACACCGTTCCCATCCGGGAACAGGGCAACATCTACAAGCCCAACAACAAGGCCATGGCAGACGAGCTGAGCGAGAAGCAAGTGTACGACGCGCACACCAAGGAGATCGACCTGGTCAACCGCGACCCTAAACACCTCAACGATGACGTGGTCAAGATTGACTTTGAAGATGTGATTGCAGAACCAGAAGGGACACACAGTTTTGACGGCATTTGGAAGGCCAGCTTCACCACCTTCACTGTGACGAAATACTGGTTTTACCGCTTGCTGTCTGCCCTCTTTGGCATCCCGATGGCACTCATCTGGGGCATTTACTTCGCCATTCTCTCTTTCCTGCACATCTGGGCAGTTGTACCATGCATTAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCGTCTGTGACCCACTCTTTGAAGCTGTTGGGAAAATATTCAGCAATGTCCGCATCAACTTGCAGAAAGAAATATAA |
| ORF Protein Sequence | MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T93945-Ab | Anti-CAV1/ BSCL3/ CGL3 monoclonal antibody |
| Target Antigen | GM-Tg-g-T93945-Ag | CAV1 VLP (virus-like particle) |
| ORF Viral Vector | pGMLV000315 | Human CAV1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000316 | Human CAV1 Lentivirus plasmid |
| ORF Viral Vector | pGMAD001567 | Human CAV1 Adenovirus plasmid |
| ORF Viral Vector | pGMAAV000856 | Human CAV1 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | pGMAP000101 | Human CAV1 Adenovirus plasmid |
| ORF Viral Vector | pGMPC000357 | Human CAV1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC000373 | Human CAV1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLV000315 | Human CAV1 Lentivirus particle |
| ORF Viral Vector | vGMLV000316 | Human CAV1 Lentivirus particle |
| ORF Viral Vector | vGMAD001567 | Human CAV1 Adenovirus particle |
| ORF Viral Vector | vGMAAV000856 | Human CAV1 Adeno-associate virus(AAV) particle |
| ORF Viral Vector | vGMAP000101 | Human CAV1 Adenovirus particle |
Target information
| Target ID | GM-T93945 |
| Target Name | Caveolin-1/CAV1 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
857 |
| Gene ID |
100055975 (Equus caballus), 12389 (Mus musculus), 25404 (Rattus norvegicus), 281040 (Bos taurus) 403980 (Canis lupus familiaris), 493668 (Felis catus), 704449 (Macaca mulatta), 857 (Homo sapiens) |
| Gene Symbols & Synonyms | CAV1,Cav1,Cav,Cav-1,Caveolin-1,CGL3,PPH3,BSCL3,LCCNS,VIP21,MSTP085 |
| Target Alternative Names | BSCL3,CAV1,CGL3,Cav,Cav-1,Cav1,Caveolin-1,LCCNS,MSTP085,PPH3,VIP21 |
| Uniprot Accession |
A0M8S7,P33724,P41350,P49817,P79132,Q03135,Q2QLB0
Additional SwissProt Accessions: Q2QLB0,P49817,P41350,P79132,P33724,A0M8S7,Q03135 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | cancer, Prostate Cancer |
| Disease from KEGG | Focal adhesion, Proteoglycans in cancer, Viral myocarditis, Fluid shear stress and atherosclerosis |
| Gene Ensembl | ENSMUSG00000007655, ENSCAFG00845006847, ENSMMUG00000014122, ENSG00000105974 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


