Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human SFRP2/FRP-2/SARP1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_003013.3)
Cat. No.: pGMPC000352
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SFRP2/FRP-2/SARP1 Non-Viral expression plasmid (overexpression vector) for mouse SFRP2 overexpression in unique cell transient transfection and stable cell line development.
Datasheet
Go to
SFRP2/FRP-2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC000352 |
| Gene Name | SFRP2 |
| Accession Number | NM_003013.3 |
| Gene ID | 6423 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 888 bp |
| Gene Alias | FRP-2,SARP1,SDF-5 |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCTGCAGGGCCCTGGCTCGCTGCTGCTGCTCTTCCTCGCCTCGCACTGCTGCCTGGGCTCGGCGCGCGGGCTCTTCCTCTTTGGCCAGCCCGACTTCTCCTACAAGCGCAGCAATTGCAAGCCCATCCCTGCCAACCTGCAGCTGTGCCACGGCATCGAATACCAGAACATGCGGCTGCCCAACCTGCTGGGCCACGAGACCATGAAGGAGGTGCTGGAGCAGGCCGGCGCTTGGATCCCGCTGGTCATGAAGCAGTGCCACCCGGACACCAAGAAGTTCCTGTGCTCGCTCTTCGCCCCCGTCTGCCTCGATGACCTAGACGAGACCATCCAGCCATGCCACTCGCTCTGCGTGCAGGTGAAGGACCGCTGCGCCCCGGTCATGTCCGCCTTCGGCTTCCCCTGGCCCGACATGCTTGAGTGCGACCGTTTCCCCCAGGACAACGACCTTTGCATCCCCCTCGCTAGCAGCGACCACCTCCTGCCAGCCACCGAGGAAGCTCCAAAGGTATGTGAAGCCTGCAAAAATAAAAATGATGATGACAACGACATAATGGAAACGCTTTGTAAAAATGATTTTGCACTGAAAATAAAAGTGAAGGAGATAACCTACATCAACCGAGATACCAAAATCATCCTGGAGACCAAGAGCAAGACCATTTACAAGCTGAACGGTGTGTCCGAAAGGGACCTGAAGAAATCGGTGCTGTGGCTCAAAGACAGCTTGCAGTGCACCTGTGAGGAGATGAACGACATCAACGCGCCCTATCTGGTCATGGGACAGAAACAGGGTGGGGAGCTGGTGATCACCTCGGTGAAGCGGTGGCAGAAGGGGCAGAGAGAGTTCAAGCGCATCTCCCGCAGCATCCGCAAGCTGCAGTGCTAG |
| ORF Protein Sequence | MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1284-Ab | Anti-SFRP2/ FRP-2/ SARP1 functional antibody |
| Target Antigen | GM-Tg-g-SE1284-Ag | SFRP2 protein |
| ORF Viral Vector | pGMLP003519 | Human SFRP2 Lentivirus plasmid |
| ORF Viral Vector | pGMLP004043 | Human SFRP2 Lentivirus plasmid |
| ORF Viral Vector | pGMPC000352 | Human SFRP2 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP003519 | Human SFRP2 Lentivirus particle |
| ORF Viral Vector | vGMLP004043 | Human SFRP2 Lentivirus particle |
Target information
| Target ID | GM-SE1284 |
| Target Name | SFRP2 |
|
Gene Group Identifier （Target Gene ID in Homo species) |
6423 |
| Gene ID |
100069959 (Equus caballus), 101093851 (Felis catus), 20319 (Mus musculus), 310552 (Rattus norvegicus) 475471 (Canis lupus familiaris), 510821 (Bos taurus), 6423 (Homo sapiens), 699915 (Macaca mulatta) |
| Gene Symbols & Synonyms | SFRP2,Sfrp2,Sdf5,FRP-2,SARP1,SDF-5,SFRP-2 |
| Target Alternative Names | FRP-2,SARP1,SDF-5,SFRP-2,SFRP2,Sdf5,Secreted apoptosis-related protein 1 (SARP-1),Secreted frizzled-related protein 2,Sfrp2,sFRP-2 |
| Uniprot Accession |
P97299,Q863H1,Q96HF1
Additional SwissProt Accessions: P97299,Q863H1,Q96HF1 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | |
| Disease | cancer |
| Disease from KEGG | Wnt signaling pathway |
| Gene Ensembl | ENSECAG00000017027, ENSMUSG00000027996, ENSBTAG00000018563, ENSG00000145423, ENSMMUG00000015851 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.