Click here to discover the largest collection of GeneMedi's Promise-ORF™ ORF/cDNA expression clones
- • Up to 20%-50%* off first purchase
- • Bulk quantities available
- • Citation Reward application
TECHNICAL RESOURCE
Supports
- Talk to our Expert:
[email protected]
Protocol Library Download
 |
 |
Human CDKN2C /INK4C/p18 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001262)
Cat. No.: pGMPC000240
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CDKN2C /INK4C/p18 Non-Viral expression plasmid (overexpression vector) for mouse CDKN2C overexpression in unique cell transient transfection and stable cell line development.
Datasheet
Go to
CDKN2C/CDKN2C /INK4C products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC000240 |
| Gene Name | CDKN2C |
| Accession Number | NM_001262 |
| Gene ID | 1031 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 507 bp |
| Gene Alias | INK4C,p18,p18-INK4C |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | Null |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCGAGCCTTGGGGGAACGAGTTGGCGTCCGCAGCTGCCAGGGGGGACCTAGAGCAACTTACTAGTTTGTTGCAAAATAATGTAAACGTCAATGCACAAAATGGATTTGGAAGGACTGCGCTGCAGGTTATGAAACTTGGAAATCCCGAGATTGCCAGGAGACTGCTACTTAGAGGTGCTAATCCCGATTTGAAAGACCGAACTGGTTTCGCTGTCATTCATGATGCGGCCAGAGCAGGTTTCCTGGACACTTTACAGACTTTGCTGGAGTTTCAAGCTGATGTTAACATCGAGGATAATGAAGGGAACCTGCCCTTGCACTTGGCTGCCAAAGAAGGCCACCTCCGGGTGGTGGAGTTCCTGGTGAAGCACACGGCCAGCAATGTGGGGCATCGGAACCATAAGGGGGACACCGCCTGTGATTTGGCCAGGCTCTATGGGAGGAATGAGGTTGTTAGCCTGATGCAGGCAAACGGGGCTGGGGGAGCCACAAATCTTCAATAA |
| ORF Protein Sequence | MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T45755-Ab | Anti-CDKN2C monoclonal antibody |
| Target Antigen | GM-Tg-g-T45755-Ag | CDKN2C protein |
| ORF Viral Vector | pGMLP000162 | Human CDKN2C Lentivirus plasmid |
| ORF Viral Vector | pGMPC000240 | Human CDKN2C Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000162 | Human CDKN2C Lentivirus particle |
Target information
| Target ID | GM-T45755 |
| Target Name | CDKN2C |
|
Gene Group Identifier （Target Gene ID in Homo species) |
1031 |
| Gene ID |
100051195 (Equus caballus), 101086582 (Felis catus), 1031 (Homo sapiens), 12580 (Mus musculus) 475359 (Canis lupus familiaris), 505691 (Bos taurus), 54238 (Rattus norvegicus), 711877 (Macaca mulatta) |
| Gene Symbols & Synonyms | CDKN2C,Cdkn2c,p18,INK4C,p18-INK4C,INK4c,p18-INK6,p18INK4c,p18-INK4c |
| Target Alternative Names | CDKN2C,Cdkn2c,Cyclin-dependent kinase 4 inhibitor C,Cyclin-dependent kinase 6 inhibitor,INK4C,INK4c,p18,p18-INK4C,p18-INK4c,p18-INK6,p18INK4c |
| Uniprot Accession |
P42773,Q60772
Additional SwissProt Accessions: P42773,Q60772 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer, Prostate Cancer |
| Disease from KEGG | Endocrine resistance, Cushing syndrome, Human T-cell leukemia virus 1 infection |
| Gene Ensembl | ENSECAG00000004817, ENSG00000123080, ENSMUSG00000028551, ENSCAFG00845024510, ENSBTAG00000011059, ENSMMUG00000019057 |
| Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.