Human BDNF/ANON2/BULN2 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_170735.5)
Cat. No.: pGMPC000188
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human BDNF/ANON2/BULN2 Non-Viral expression plasmid (overexpression vector) for mouse BDNF overexpression in unique cell transient transfection and stable cell line development.
Go to
BDNF/ANON2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMPC000188 |
| Gene Name | BDNF |
| Accession Number | NM_170735.5 |
| Gene ID | 627 |
| Species | Human |
| Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
| Insert Length | 744 bp |
| Gene Alias | ANON2,BULN2 |
| Fluorescent Reporter | EGFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGACCATCCTTTTCCTTACTATGGTTATTTCATACTTTGGTTGCATGAAGGCTGCCCCCATGAAAGAAGCAAACATCCGAGGACAAGGTGGCTTGGCCTACCCAGGTGTGCGGACCCATGGGACTCTGGAGAGCGTGAATGGGCCCAAGGCAGGTTCAAGAGGCTTGACATCATTGGCTGACACTTTCGAACACGTGATAGAAGAGCTGTTGGATGAGGACCAGAAAGTTCGGCCCAATGAAGAAAACAATAAGGACGCAGACTTGTACACGTCCAGGGTGATGCTCAGTAGTCAAGTGCCTTTGGAGCCTCCTCTTCTCTTTCTGCTGGAGGAATACAAAAATTACCTAGATGCTGCAAACATGTCCATGAGGGTCCGGCGCCACTCTGACCCTGCCCGCCGAGGGGAGCTGAGCGTGTGTGACAGTATTAGTGAGTGGGTAACGGCGGCAGACAAAAAGACTGCAGTGGACATGTCGGGCGGGACGGTCACAGTCCTTGAAAAGGTCCCTGTATCAAAAGGCCAACTGAAGCAATACTTCTACGAGACCAAGTGCAATCCCATGGGTTACACAAAAGAAGGCTGCAGGGGCATAGACAAAAGGCATTGGAACTCCCAGTGCCGAACTACCCAGTCGTACGTGCGGGCCCTTACCATGGATAGCAAAAAGAGAATTGGCTGGCGATTCATAAGGATAGACACTTCTTGTGTATGTACATTGACCATTAAAAGGGGAAGATAG |
| ORF Protein Sequence | MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T93122-Ab | Anti-BDNF/ ANON2/ BULN2 functional antibody |
| Target Antigen | GM-Tg-g-T93122-Ag | BDNF protein |
| ORF Viral Vector | pGMLP004025 | Human BDNF Lentivirus plasmid |
| ORF Viral Vector | pGMAD000577 | Human BDNF Adenovirus plasmid |
| ORF Viral Vector | pGMAAV000575 | Human BDNF Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | pGMAP000316 | Human BDNF Adenovirus plasmid |
| ORF Viral Vector | pGMPC000136 | Human BNDF Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC000188 | Human BDNF Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC004727 | Human BDNF Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP004025 | Human BDNF Lentivirus particle |
| ORF Viral Vector | vGMAD000577 | Human BDNF Adenovirus particle |
| ORF Viral Vector | vGMAAV000575 | Human BDNF Adeno-associate virus(AAV) particle |
| ORF Viral Vector | vGMAP000316 | Human BDNF Adenovirus particle |
Target information
| Target ID | GM-T93122 |
| Target Name | BDNF |
|
Gene Group Identifier (Target Gene ID in Homo species) |
627 |
| Gene ID |
100009689 (Equus caballus), 12064 (Mus musculus), 24225 (Rattus norvegicus), 403461 (Canis lupus familiaris) 493690 (Felis catus), 617701 (Bos taurus), 627 (Homo sapiens), 701245 (Macaca mulatta) |
| Gene Symbols & Synonyms | BDNF,Bdnf,ANON2,BULN2 |
| Target Alternative Names | ANON2,Abrineurin,BDNF,BULN2,Bdnf,Brain-derived neurotrophic factor,Neurotrophic factor BDNF precursor form,proBDNF |
| Uniprot Accession |
P21237,P23363,P23560,Q06225,Q0EAB7,Q7YRB4,Q95106,Q9TST3
Additional SwissProt Accessions: Q0EAB7,P21237,P23363,Q7YRB4,Q9TST3,Q95106,P23560,Q06225 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | cancer, Prostate Cancer, ovarian cancer, Overactive bladder, Autism, mental retardation, Allergic reactions, Asthma, Parkinson's Disease |
| Disease from KEGG | MAPK signaling pathway, Ras signaling pathway, cAMP signaling pathway, PI3K-Akt signaling pathway, Neurotrophin signaling pathway, Cocaine addiction |
| Gene Ensembl | ENSECAG00000015952, ENSMUSG00000048482, ENSBTAG00000008134, ENSG00000176697, ENSMMUG00000008634 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


