Human SFN/YWHAS ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_006142.5)

Cat. No.: pGMPC000161
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SFN/YWHAS Non-Viral expression plasmid (overexpression vector) for mouse SFN overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to SFN/YWHAS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000161
Gene Name SFN
Accession Number NM_006142.5
Gene ID 2810
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 747 bp
Gene Alias YWHAS
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGAGAGCCAGTCTGATCCAGAAGGCCAAGCTGGCAGAGCAGGCCGAACGCTATGAGGACATGGCAGCCTTCATGAAAGGCGCCGTGGAGAAGGGCGAGGAGCTCTCCTGCGAAGAGCGAAACCTGCTCTCAGTAGCCTATAAGAACGTGGTGGGCGGCCAGAGGGCTGCCTGGAGGGTGCTGTCCAGTATTGAGCAGAAAAGCAACGAGGAGGGCTCGGAGGAGAAGGGGCCCGAGGTGCGTGAGTACCGGGAGAAGGTGGAGACTGAGCTCCAGGGCGTGTGCGACACCGTGCTGGGCCTGCTGGACAGCCACCTCATCAAGGAGGCCGGGGACGCCGAGAGCCGGGTCTTCTACCTGAAGATGAAGGGTGACTACTACCGCTACCTGGCCGAGGTGGCCACCGGTGACGACAAGAAGCGCATCATTGACTCAGCCCGGTCAGCCTACCAGGAGGCCATGGACATCAGCAAGAAGGAGATGCCGCCCACCAACCCCATCCGCCTGGGCCTGGCCCTGAACTTTTCCGTCTTCCACTACGAGATCGCCAACAGCCCCGAGGAGGCCATCTCTCTGGCCAAGACCACTTTCGACGAGGCCATGGCTGATCTGCACACCCTCAGCGAGGACTCCTACAAAGACAGCACCCTCATCATGCAGCTGCTGCGAGACAACCTGACACTGTGGACGGCCGACAACGCCGGGGAAGAGGGGGGCGAGGCTCCCCAGGAGCCCCAGAGCTGA
ORF Protein Sequence MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1283-Ab Anti-1433S/ SFN/ YWHAS functional antibody
    Target Antigen GM-Tg-g-SE1283-Ag SFN protein
    ORF Viral Vector pGMLP002188 Human SFN Lentivirus plasmid
    ORF Viral Vector pGMPC000161 Human SFN Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002188 Human SFN Lentivirus particle


    Target information

    Target ID GM-SE1283
    Target Name SFN
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2810
    Gene ID 100057082 (Equus caballus), 101087501 (Felis catus), 2810 (Homo sapiens), 313017 (Rattus norvegicus)
    487351 (Canis lupus familiaris), 528453 (Bos taurus), 55948 (Mus musculus), 715055 (Macaca mulatta)
    Gene Symbols & Synonyms SFN,Sfn,YWHAS,Er,Mme1,Ywhas,14-3-3
    Target Alternative Names 14-3-3,14-3-3 protein sigma,Epithelial cell marker protein 1,Er,Mme1,SFN,Sfn,Stratifin,YWHAS,Ywhas
    Uniprot Accession O70456,P31947,Q0VC36
    Additional SwissProt Accessions: P31947,Q0VC36,O70456
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG p53 signaling pathway, Aldosterone-regulated sodium reabsorption
    Gene Ensembl ENSG00000175793, ENSBTAG00000009223, ENSMUSG00000047281, ENSMMUG00000013855
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.