Human CDKN1B/CDKN4/KIP1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_004064.4)

Cat. No.: pGMPC000041
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CDKN1B/CDKN4/KIP1 Non-Viral expression plasmid (overexpression vector) for mouse CDKN1B overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to P27/KIP1/CDKN1B/CDKN1B/CDKN4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000041
Gene Name CDKN1B
Accession Number NM_004064.4
Gene ID 1027
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 597 bp
Gene Alias CDKN4,KIP1,MEN1B,MEN4,P27KIP1
Fluorescent Reporter Firefly luciferase
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCAAACGTGCGAGTGTCTAACGGGAGCCCTAGCCTGGAGCGGATGGACGCCAGGCAGGCGGAGCACCCCAAGCCCTCGGCCTGCAGGAACCTCTTCGGCCCGGTGGACCACGAAGAGTTAACCCGGGACTTGGAGAAGCACTGCAGAGACATGGAAGAGGCGAGCCAGCGCAAGTGGAATTTCGATTTTCAGAATCACAAACCCCTAGAGGGCAAGTACGAGTGGCAAGAGGTGGAGAAGGGCAGCTTGCCCGAGTTCTACTACAGACCCCCGCGGCCCCCCAAAGGTGCCTGCAAGGTGCCGGCGCAGGAGAGCCAGGATGTCAGCGGGAGCCGCCCGGCGGCGCCTTTAATTGGGGCTCCGGCTAACTCTGAGGACACGCATTTGGTGGACCCAAAGACTGATCCGTCGGACAGCCAGACGGGGTTAGCGGAGCAATGCGCAGGAATAAGGAAGCGACCTGCAACCGACGATTCTTCTACTCAAAACAAAAGAGCCAACAGAACAGAAGAAAATGTTTCAGACGGTTCCCCAAATGCCGGTTCTGTGGAGCAGACGCCCAAGAAGCCTGGCCTCAGAAGACGTCAAACGTAA
ORF Protein Sequence MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T14006-Ab Anti-CDKN1B monoclonal antibody
    Target Antigen GM-Tg-g-T14006-Ag CDKN1B protein
    ORF Viral Vector pGMLP003982 Human CDKN1B Lentivirus plasmid
    ORF Viral Vector pGMPC000041 Human CDKN1B Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003982 Human CDKN1B Lentivirus particle


    Target information

    Target ID GM-T14006
    Target Name P27/KIP1/CDKN1B
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1027
    Gene ID 1027 (Homo sapiens), 111773925 (Equus caballus), 12576 (Mus musculus), 403429 (Canis lupus familiaris)
    493958 (Felis catus), 512613 (Bos taurus), 697188 (Macaca mulatta), 83571 (Rattus norvegicus)
    Gene Symbols & Synonyms CDKN1B,Cdkn1b,KIP1,MEN4,CDKN4,MEN1B,P27KIP1,p27,Kip1,p27Kip1,Cdki1b
    Target Alternative Names CDKN1B,CDKN4,Cdki1b,Cdkn1b,Cyclin-dependent kinase inhibitor 1B,Cyclin-dependent kinase inhibitor p27,KIP1,Kip1,MEN1B,MEN4,P27,P27KIP1,p27,p27Kip1
    Uniprot Accession O19001,P46414,P46527,Q6SLL5
    Additional SwissProt Accessions: P46527,P46414,Q6SLL5,O19001
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG Endocrine resistance, ErbB signaling pathway, HIF-1 signaling pathway, FoxO signaling pathway, PI3K-Akt signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Cushing syndrome, Measles, Human papillomavirus infection, Epstein-Barr virus infection, Pathways in cancer, Prostate cancer, Chronic myeloid leukemia, Small cell lung cancer, Gastric cancer
    Gene Ensembl ENSG00000111276, ENSMUSG00000003031, ENSCAFG00845023770, ENSBTAG00000018254, ENSMMUG00000050457
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.