Human LY6D/E48/Ly-6D ORF/cDNA clone-Lentivirus plasmid (NM_003695.3)

Cat. No.: pGMLV002718
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human LY6D/E48/Ly-6D Lentiviral expression plasmid for LY6D lentivirus packaging, LY6D lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to LY6D/E48 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV002718
Gene Name LY6D
Accession Number NM_003695.3
Gene ID 8581
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 387 bp
Gene Alias E48,Ly-6D
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag 1xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGGACAGCATTGCTGCTCCTTGCAGCCCTGGCTGTGGCTACAGGGCCAGCCCTTACCCTGCGCTGCCACGTGTGCACCAGCTCCAGCAACTGCAAGCATTCTGTGGTCTGCCCGGCCAGCTCTCGCTTCTGCAAGACCACGAACACAGTGGAGCCTCTGAGGGGGAATCTGGTGAAGAAGGACTGTGCGGAGTCGTGCACACCCAGCTACACCCTGCAAGGCCAGGTCAGCAGCGGCACCAGCTCCACCCAGTGCTGCCAGGAGGACCTGTGCAATGAGAAGCTGCACAACGCTGCACCCACCCGCACCGCCCTCGCCCACAGTGCCCTCAGCCTGGGGCTGGCCCTGAGCCTCCTGGCCGTCATCTTAGCCCCCAGCCTGTGA
ORF Protein Sequence MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T03317-Ab Anti-LY6D/ E48/ Ly-6D monoclonal antibody
    Target Antigen GM-Tg-g-T03317-Ag LY6D VLP (virus-like particle)
    ORF Viral Vector pGMLV002718 Human LY6D Lentivirus plasmid
    ORF Viral Vector vGMLV002718 Human LY6D Lentivirus particle


    Target information

    Target ID GM-T03317
    Target Name LY6D
    Gene Group Identifier
    (Target Gene ID in Homo species)
    8581
    Gene ID 100063680 (Equus caballus), 111558518 (Felis catus), 17068 (Mus musculus), 315075 (Rattus norvegicus)
    609112 (Canis lupus familiaris), 618714 (Bos taurus), 695450 (Macaca mulatta), 8581 (Homo sapiens)
    Gene Symbols & Synonyms LY6D,Ly6d,Thb,Ly61,Ly-61,E48,Ly-6D
    Target Alternative Names E48,E48 antigen,LY6D,Ly-61,Ly-6D,Ly61,Ly6d,Lymphocyte antigen 6D,Thb
    Uniprot Accession P35459,Q14210,Q148C3
    Additional SwissProt Accessions: P35459,Q148C3,Q14210
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSMUSG00000034634, ENSCAFG00845014421, ENSBTAG00000034498, ENSMMUG00000060008, ENSG00000167656
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.