Human TACSTD2/EGP-1/EGP1 ORF/cDNA clone-Lentivirus plasmid (NM_002353.3)
Cat. No.: pGMLV002492
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TACSTD2/EGP-1/EGP1 Lentiviral expression plasmid for TACSTD2 lentivirus packaging, TACSTD2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
TACSTD2/TROP2/TACSTD2/EGP-1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV002492 |
| Gene Name | TACSTD2 |
| Accession Number | NM_002353.3 |
| Gene ID | 4070 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 972 bp |
| Gene Alias | EGP-1,EGP1,GA733-1,GA7331,GP50,M1S1,TROP2 |
| Fluorescent Reporter | mCherry |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCTCGGGGCCCCGGCCTCGCGCCGCCACCGCTGCGGCTGCCGCTGCTGCTGCTGGTGCTGGCGGCGGTGACCGGCCACACGGCCGCGCAGGACAACTGCACGTGTCCCACCAACAAGATGACCGTGTGCAGCCCCGACGGCCCCGGCGGCCGCTGCCAGTGCCGCGCGCTGGGCTCGGGCATGGCGGTCGACTGCTCCACGCTGACCTCCAAGTGTCTGCTGCTCAAGGCGCGCATGAGCGCCCCCAAGAACGCCCGCACGCTGGTGCGGCCGAGTGAGCACGCGCTCGTGGACAACGATGGCCTCTACGACCCCGACTGCGACCCCGAGGGCCGCTTCAAGGCGCGCCAGTGCAACCAGACGTCGGTGTGCTGGTGCGTGAACTCGGTGGGCGTGCGCCGCACGGACAAGGGCGACCTGAGCCTACGCTGCGATGAGCTGGTGCGCACCCACCACATCCTCATTGACCTGCGCCACCGCCCCACCGCCGGCGCCTTCAACCACTCAGACCTGGACGCCGAGCTGAGGCGGCTCTTCCGCGAGCGCTATCGGCTGCACCCCAAGTTCGTGGCGGCCGTGCACTACGAGCAGCCCACCATCCAGATCGAGCTGCGGCAGAACACGTCTCAGAAGGCCGCCGGTGACGTGGATATCGGCGATGCCGCCTACTACTTCGAGAGGGACATCAAGGGCGAGTCTCTATTCCAGGGCCGCGGCGGCCTGGACTTGCGCGTGCGCGGAGAACCCCTGCAGGTGGAGCGCACGCTCATCTATTACCTGGACGAGATTCCCCCGAAGTTCTCCATGAAGCGCCTCACCGCCGGCCTCATCGCCGTCATCGTGGTGGTCGTGGTGGCCCTCGTCGCCGGCATGGCCGTCCTGGTGATCACCAACCGGAGAAAGTCGGGGAAGTACAAGAAGGTGGAGATCAAGGAACTGGGGGAGTTGAGAAAGGAACCGAGCTTGTAG |
| ORF Protein Sequence | MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Target information
| Target ID | GM-IP0030 |
| Target Name | TACSTD2/TROP2 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
4070 |
| Gene ID |
100067576 (Equus caballus), 101097004 (Felis catus), 4070 (Homo sapiens), 494343 (Rattus norvegicus) 539853 (Bos taurus), 56753 (Mus musculus), 610286 (Canis lupus familiaris), 716334 (Macaca mulatta) |
| Gene Symbols & Synonyms | TACSTD2,Tacstd2,EGP1,GP50,M1S1,EGP-1,TROP2,GA7331,GA733-1,Prp1,Trop2,Ly97 |
| Target Alternative Names | Cell surface glycoprotein Trop-2,EGP-1,EGP1,GA733-1,GA7331,GP50,Ly97,M1S1,Membrane component chromosome 1 surface marker 1,Pancreatic carcinoma marker protein GA733-1,Prp1,TACSTD2,TROP2,Tacstd2,Trop2,Tumor-associated calcium signal transducer 2 |
| Uniprot Accession |
P09758,Q6P9Z6,Q8BGV3
Additional SwissProt Accessions: P09758,Q6P9Z6,Q8BGV3 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target, Immuno-oncology Target, INN Index |
| Disease | cancer |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000004961, ENSG00000184292, ENSBTAG00000004381, ENSMUSG00000051397 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


