Human B2M/IMD43 ORF/cDNA clone-Lentivirus plasmid (NM_004048)
Cat. No.: pGMLV002489
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human B2M/IMD43 Lentiviral expression plasmid for B2M lentivirus packaging, B2M lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
B2M/Beta-2-Microglobulin/B2M/IMD43 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV002489 |
| Gene Name | B2M |
| Accession Number | NM_004048 |
| Gene ID | 567 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 360 bp |
| Gene Alias | IMD43 |
| Fluorescent Reporter | mCherry |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | Null |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCTCGCTCCGTGGCCTTAGCTGTGCTCGCGCTACTCTCTCTTTCTGGCCTGGAGGCTATCCAGCGTACTCCAAAGATTCAGGTTTACTCACGTCATCCAGCAGAGAATGGAAAGTCAAATTTCCTGAATTGCTATGTGTCTGGGTTTCATCCATCCGACATTGAAGTTGACTTACTGAAGAATGGAGAGAGAATTGAAAAAGTGGAGCATTCAGACTTGTCTTTCAGCAAGGACTGGTCTTTCTATCTCTTGTACTACACTGAATTCACCCCCACTGAAAAAGATGAGTATGCCTGCCGTGTGAACCATGTGACTTTGTCACAGCCCAAGATAGTTAAGTGGGATCGAGACATGTAA |
| ORF Protein Sequence | MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T58080-Ab | Anti-B2MG/ B2M/ IMD43 monoclonal antibody |
| Target Antigen | GM-Tg-g-T58080-Ag | B2M VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000539 | Human B2M Lentivirus plasmid |
| ORF Viral Vector | pGMLV002489 | Human B2M Lentivirus plasmid |
| ORF Viral Vector | pGMAP000411 | Human B2M Adenovirus plasmid |
| ORF Viral Vector | vGMLP000539 | Human B2M Lentivirus particle |
| ORF Viral Vector | vGMLV002489 | Human B2M Lentivirus particle |
| ORF Viral Vector | vGMAP000411 | Human B2M Adenovirus particle |
Target information
| Target ID | GM-T58080 |
| Target Name | B2M/Beta-2-Microglobulin |
|
Gene Group Identifier (Target Gene ID in Homo species) |
567 |
| Gene ID |
100034203 (Equus caballus), 100855741 (Canis lupus familiaris), 12010 (Mus musculus), 24223 (Rattus norvegicus) 494145 (Felis catus), 567 (Homo sapiens), 712428 (Macaca mulatta) |
| Gene Symbols & Synonyms | B2M,B2m,Ly-m11,beta2m,beta2-m,IMD43,AMYLD6,MHC1D4 |
| Target Alternative Names | AMYLD6,B2M,B2m,Beta-2-Microglobulin,Beta-2-microglobulin,IMD43,Ly-m11,MHC1D4,beta2-m,beta2m |
| Uniprot Accession |
P01887,P07151,P19341,P30441,P61769,Q5MGS7,Q6V7J5
Additional SwissProt Accessions: P30441,P19341,P01887,P07151,Q5MGS7,P61769,Q6V7J5 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Diagnostics Biomarker |
| Disease | cancer, Ovary Cancer, Urinary tract obstruction, Malignant neoplasm of prostate, Congenital occlusion of ureteropelvic junction, Acute kidney failure, Asphyxia neonatorum, Autosomal Dominant Polycystic Kidney Disease, Balkan nephropathy, Bronchopulmonary Dysplasia, Dent disease, Kidney transplant rejection, lymphomas, Malignant neoplasm of colon, Nephropathy induced by other drugs, medicaments and biological substances, Nephrotic syndrome, Proteinuria, Renal fibrosis, Peripheral T-cell lymphomas (PTCL) |
| Disease from KEGG | Antigen processing and presentation, Human cytomegalovirus infection, Human T-cell leukemia virus 1 infection, Epstein-Barr virus infection |
| Gene Ensembl | ENSMUSG00000060802, ENSG00000166710, ENSMMUG00000060797 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


